FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 290 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5781	MYP_107813	XKRRRRRRE	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
5782	MYP_107814	CNRRTKAGC	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5783	MYP_107816	CRTCNGRCLE	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
5784	MYP_107817	VKRFKKFFRKLKKSV	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
5785	MYP_107819	VVPCEPPEV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
5786	MYP_107832	FYPRPYRPPYLPDPRPFPRPLPAFGHEFRRH	STANDARD	Antimicrobial Anticancer	Procambarus clarkii [Animal]	YES
5787	MYP_107834	WG	STANDARD	ACE inhibitory Antihypertensive	Solanum tuberosum [Plant]	YES
5788	MYP_107866	YHWYGYTPQN	STANDARD	Anticancer	not reported [other]	NO
5789	MYP_107884	GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN	STANDARD	Anticancer	not reported [other]	NO
5790	MYP_107906	ATRVVYCNRRSGSVVGGDDTVYYEG	STANDARD	Antimicrobial Antifungal Antibacterial	Pleurotus eryngii [Fungus]	YES
5791	MYP_107921	PSTLTSS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
5792	MYP_107954	HKLSNSEQFRRFGLVVSKAVGNAVTRHRVSRQLRHFHVVLRADVQAAL	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
5793	MYP_107973	XKAPKVVXLSKALEYL	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5794	MYP_107979	AAVLLPVLLAAP	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
5795	MYP_107981	XACRGRGRGCRGRGRGCG	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
5796	MYP_108026	MRPEIWIAQELRRNGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
5797	MYP_108033	MAPQRDTVGGRTTPPSWGPAKAQLRNSCA	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
5798	MYP_108043	TCRSSGRYCRSPYDRARRYCRRITDACV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5799	MYP_108060	EIWIAQELRRIGDSFNAYYAR	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
5800	MYP_108061	GKWMSALKHILK	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO