FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 287 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5721	MYP_106767	GXXKKXXKKXXKKX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
5722	MYP_106775	RPHVPESAF	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
5723	MYP_106796	HY	STANDARD	Antihypertensive	Oryza sativa [Plant]; Vigna radiata [Plant]	NO
5724	MYP_106802	KLYAWELAF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5725	MYP_106810	RVIDAVRFTL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5726	MYP_106825	LTAEHYAAQATS	STANDARD	Anticancer Antitumor	not reported [other]	NO
5727	MYP_106851	MNKLFIVALVVALAVATMAQEVHNDVEEQSVPRVRRGYGCPFNQYQCHSHCSGIRGYKGGYCKGTFKQTCKCY	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
5728	MYP_106853	LLLR	STANDARD	Cellular uptake tested Poor cell penetration	synthetic construct [Synthetic]	YES
5729	MYP_106889	GPSRVGG	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
5730	MYP_106970	TVGMTAKF	STANDARD	Enzyme inhibitory ACE inhibitory	Macrotyloma uniflorum [Plant]	YES
5731	MYP_106982	NDESEWFSYHLSFFNSV	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	NO
5732	MYP_106984	GGGARKKAAKAARKKAAKAARKKAAKAARKKAAKA	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
5733	MYP_106999	NVPGNVPG	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
5734	MYP_107022	WQPDTAHHWATL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide PSMA-targeting Protein-binding Enzyme inhibitory	synthetic construct [Synthetic]	YES
5735	MYP_107040	GLPLLISWIKRKRQQAGPGSKKPVPIIYCNRRTGKCQRM	STANDARD	Hemolytic	synthetic construct [Synthetic]	YES
5736	MYP_107066	FLPVIAGLLSKLF	STANDARD	Antimicrobial Antibacterial	not reported [other]	YES
5737	MYP_107084	DFATPSLHTSV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
5738	MYP_107159	CYMEAVALV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
5739	MYP_107177	GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-negative	Hylomantis lemur [Animal]	YES
5740	MYP_107187	LTVSPWYGCGKLAKLAKKLAKLAK	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES