FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 283 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5641	MYP_105134	RLXRXRXX	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	NO
5642	MYP_105139	WCRRYRVLVRGVLVRYRRCW	STANDARD	Anti-Gram-positive Anti-Gram-negative Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
5643	MYP_105140	GAHKEVFKRDTALTKEAAKKAKK	STANDARD	Anti-proliferative Cytotoxic	not reported [other]	NO
5644	MYP_105156	LRLKLRLKLRLK	STANDARD	Antimicrobial Anticancer	cationic amphiphilic peptides [other]	YES
5645	MYP_105158	AKKVFKRLEKLFSKIQNWK	STANDARD	Anti-Gram-positive Anti-Gram-negative Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
5646	MYP_105172	GFKDLLKGAA	STANDARD	Anticancer	not reported [other]	NO
5647	MYP_105188	TCCATGACGTTCCTGACGTT	STANDARD	Anticancer	not reported [other]	NO
5648	MYP_105190	EPNPDEFFGLM	STANDARD	Antibacterial Antimicrobial	not reported [other]	YES
5649	MYP_105194	DXAXG	NOT STANDARD	Targeting Anticancer	synthetic construct [Synthetic]	NO
5650	MYP_105244	DWTAWSALVAAACSVELL	STANDARD	Anti-Gram-positive Anti-Gram-negative Antimicrobial Antibacterial	Bacillus thuringiensis serovar entomocidus [Bacterium]	YES
5651	MYP_105256	TECDMSRCM	STANDARD	Tumor homing peptide Drug delivery vehicle Anticancer	synthetic construct [Synthetic]	YES
5652	MYP_105257	YKQCHKKGGKKGSG	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
5653	MYP_105260	GFKSLLKSAAKALVKTVLF	STANDARD	Antitumor Anticancer	synthetic construct [Synthetic]	YES
5654	MYP_105285	TAWYANFEXLLX	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
5655	MYP_105298	RWRWRWX	NOT STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
5656	MYP_105299	GMWSKIPGHLIR	STANDARD	Antimicrobial Antibacterial	not reported [other]	NO
5657	MYP_105312	FAIVELLA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5658	MYP_105313	RFRWPIRRRPIRPPFYP	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
5659	MYP_105376	IDLGPPISLERLDVGTNLGNAIAKLEDAKELLESS	STANDARD	Fusion inhibitor Cytoprotective Antiviral	Measles morbillivirus [Virus]	YES
5660	MYP_105378	YGRKKRRQRRRGGGLGASWHRPDKGGGGLRRMADDLNAQY	STANDARD	Apoptosis induction Antitumor Anticancer Cytotoxic	synthetic construct [Synthetic]	YES