FUNCTION: ANTICANCER

Found 13,621 peptides

Current Node: Anticancer | Page 28 of 682

Level 2 Subcategories

Cytotoxic anticancer activity (8360) Tumor Homing Peptide (659) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (27) tumor necrosis factor family (19) Anti-breast cancer (9) Prostate cancer targeting (2) Anti-angiogenic activity (1) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
541	MYP_006695	EETPPFSNY	STANDARD	Anticancer	Homo sapiens [Animal]	NO
542	MYP_006702	SKQCCHLAACRFRCTPCCW	STANDARD	Toxic Cytotoxic	not reported [other]	YES
543	MYP_006705	TSWSQCSKTCGTGISTRV	STANDARD	Anticancer Anti-angiogenic	not reported [other]	NO
544	MYP_006708	VLPILLLV	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
545	MYP_006728	AWKETIRKYLKNEIKKKWRKAVIAW	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
546	MYP_006739	YQLLIRAIYKNI	STANDARD	Antiviral Integrase inhibition	synthetic construct [Synthetic]	YES
547	MYP_006743	CGLMCQGACFDVC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
548	MYP_006769	VDQTVFKDIWWRMKQWKQRVKKRAAKYNV	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
549	MYP_006813	LNKRCLEFGEVCNFFFPTCCGYCVLLVCL	STANDARD	Toxic Cytotoxic	not reported [other]	YES
550	MYP_006814	LLKKKFKLKQ	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
551	MYP_006817	SYPLSFLGPLIS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
552	MYP_006841	WPFCLLLMAL	STANDARD	Antimicrobial Antiviral Hemolytic	synthetic construct [Synthetic]	YES
553	MYP_006896	FAIAIKAIKKAIKKIKKAIKKAI	STANDARD	Antiviral Antimicrobial	not reported [other]	YES
554	MYP_006916	KWKSFLKTFKSLKKTVLHTLLKLISS	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
555	MYP_006943	CSTNTFSLSDYWGNKGNWCTATHECMSWCK	STANDARD	Antimicrobial	Staphylococcus aureus [Bacterium]; Bacteria [Bacterium]	NO
556	MYP_006945	XXXSYNLXPA	NOT STANDARD	Anticancer Hormone replacement	synthetic construct [Synthetic]	NO
557	MYP_006946	FLPILINLIHGKLL	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
558	MYP_007007	NHFTLKCPKT	STANDARD	Anticancer	not reported [other]	NO
559	MYP_007013	WLPKILGEV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
560	MYP_007026	KQLIRFLKRLDRN	STANDARD	Anticancer	synthetic construct [Synthetic]	YES