FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 278 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5541	MYP_103597	VTYSGKFLI	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
5542	MYP_103606	FIGLLISAGKAIHDLIRRRH	STANDARD	Anti-Gram-positive Anti-Gram-negative Antimicrobial Antibacterial	Pagrus major [Animal]	YES
5543	MYP_103609	LALALALALALALALAKIKKIKKIKKIKKLAKLAKKIK	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
5544	MYP_103615	VKRFKSFFRSLKKLV	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
5545	MYP_103650	LPSSADVEF	STANDARD	Anticancer	Homo sapiens [Animal]	NO
5546	MYP_103666	CLLFVY	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
5547	MYP_103672	KRIHPRLTRSIR	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
5548	MYP_103691	FAFDAVSKPGL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
5549	MYP_103698	YRGDS	STANDARD	Anticancer	not reported [other]	NO
5550	MYP_103706	CCTAAGCCCTTGTGGTGTGT	STANDARD	Anticancer	not reported [other]	NO
5551	MYP_103716	KXFQWQRNMRKVRGPPVSXIKR	NOT STANDARD	Antimicrobial Anticancer	Protein derived [Animal]	NO
5552	MYP_103717	YIIKGVFWDPAC	STANDARD	Anticancer	not reported [other]	NO
5553	MYP_103718	GKAFRR	STANDARD	Anticancer	Homo sapiens [Animal]	YES
5554	MYP_103742	QLLLLIRKLIL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
5555	MYP_103759	APKVVXLSKALEXLQA	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5556	MYP_103863	PEWFKCRRWQWRMKKLGA	STANDARD	Anticancer Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Cytotoxic	not reported [other]	NO
5557	MYP_103877	TKRRITPKDVIDVESVTTEINT	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	NO
5558	MYP_103903	MAFLKKSLFLVLFLGLVSLSIGEEEKREEEEKNEEGANQEENAENKEKRFIGTLIPLALGALTKLFKG	STANDARD	Defense peptide Antimicrobial Antibiotic Antifungal Anti-Candida Antiparasitic Antiprotozoal Anti-Gram-negative Anti-Gram-positive Cytolytic Anticancer Non-hemolytic	Boana raniceps [Animal]	NO
5559	MYP_103913	RDQTMNEKDGRNLDSLGGGN	STANDARD	Anticancer	not reported [other]	NO
5560	MYP_103937	DKPKKKPPPPAGPPPPPPPPPGPPPPGP	STANDARD	Antimicrobial Antifungal Anticancer	Sus scrofa [Animal]	YES