FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 267 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5321	MYP_099572	GLPVCGETCFGGTCNTPGCSCXTWPVCSRN	NOT STANDARD	Anticancer Cytotoxic	Viola arvensis [Plant]; Viola tricolor [Plant]	YES
5322	MYP_099573	HARIKPTARRLAWKYKGKFA	STANDARD	Immunomodulatory Anticancer	synthetic construct [Synthetic]	NO
5323	MYP_099623	VLCLR	STANDARD	Antimicrobial Anticancer Hemolytic	Protein derived [Animal]	NO
5324	MYP_099687	GLPVCGETCFGGTCNTPGCTCDPWPVCTRN	STANDARD	Antimicrobial Antibacterial Antifungal Cytotoxic	Viola abyssinica [Plant]	YES
5325	MYP_099708	RCFQWQRNMRRVRGPPVSCIRR	STANDARD	Antimicrobial Anticancer Cytotoxic	Protein derived [Animal]	NO
5326	MYP_099721	RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN	STANDARD	Antimicrobial Anticancer Hemolytic	Dendroaspis angusticeps [Animal]	YES
5327	MYP_099728	YALRAH	STANDARD	Antimicrobial Anticancer Cytotoxic	Heated products [Animal]	NO
5328	MYP_099741	FAKKLAKKLKKLAKKLAKLALAL	STANDARD	Anticancer	not reported [other]	NO
5329	MYP_099757	VKLPPPVKLPPPVKLPPP	STANDARD	Antimicrobial Anticancer Cytotoxic	Protein derived [Animal]	NO
5330	MYP_099784	KRLLTPRHFKRLGLVIGKKSVKLAVQRNRLKRLMRDLDIVILHQHF	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
5331	MYP_099860	LKKVLKAAAKAALNAVLVGANA	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
5332	MYP_099881	ASVVNKLTKKVAKLLK	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
5333	MYP_099882	RWRIRWRWL	STANDARD	Anticancer Toxin-related activity Antifungal Antibacterial Antimicrobial	not reported [other]	NO
5334	MYP_099885	KRFKQDGGAS	STANDARD	Anticancer	not reported [other]	NO
5335	MYP_099907	TSLDASIWAMMQNA	STANDARD	Antimicrobial Anticancer Hemolytic	derived from the extracellular sequence of the human TGF-β type III receptor [Animal]	NO
5336	MYP_099914	ALYGFVPVL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
5337	MYP_099944	NLRTYKKRYMFY	STANDARD	Antimicrobial Antibacterial Antiparasitic Antiprotozoal Anticancer Antitumor Anti-Gram-negative	Bothrops godmani [Animal]	YES
5338	MYP_100014	FKCRRWQWRMKKLGAPSITCVR	STANDARD	Anticancer Cytotoxic Anti-HSV-1 Antiviral Antileukemic Pro-apoptotic Cell-proliferative	Bos taurus [Animal]	YES
5339	MYP_100030	YARKARRAARR	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
5340	MYP_100046	XASYQSL	NOT STANDARD	Anticancer Targeting	synthetic construct [Synthetic]	NO