FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 256 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5101	MYP_095411	LRLKHWQDFQRFGITVSQKVSKKATVRNRLKRQIRAIKDVVIFLREL	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
5102	MYP_095440	WYANFEKLLA	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
5103	MYP_095459	FIWGDAPPT	STANDARD	Anticancer	Homo sapiens [Animal]	NO
5104	MYP_095470	RRRFFFFFRRR	STANDARD	Cytotoxic Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
5105	MYP_095478	VRRFKWWWKFLRR	STANDARD	Cytotoxic Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
5106	MYP_095502	GLFGVLGSIAKHVLPHVVPVIAEKL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Antifungal Antiviral	Litoria chloris [Animal]	YES
5107	MYP_095504	GLAPPQHLIRV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
5108	MYP_095512	TPGSPEFDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
5109	MYP_095565	HLGSLYKPRRNDDSFDNFDEE	STANDARD	Neuropeptide	Procambarus clarkii [Animal]	NO
5110	MYP_095594	IIIR	STANDARD	Antimicrobial Anticancer Cytotoxic	Protein derived [Animal]	YES
5111	MYP_095599	AKTIAYDEEARRGLE	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
5112	MYP_095609	SMPINSPYIPWS	STANDARD	Anticancer Tumor-targeting Gastric cancer-binding peptide Metastasis inhibition	not reported [other]	YES
5113	MYP_095644	HEHEHEHEHEHEHEHEHEHEHEHEEFGGGGGYGRGRGRGRGRGRG	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
5114	MYP_095666	MRPEIWAAQEARRAGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
5115	MYP_095677	TYKYVDINTF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5116	MYP_095705	DASTKKLSECLRRIGDELDS	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5117	MYP_095725	GKKLKKIGQKIKNFFQKL	STANDARD	Antimicrobial Antifungal Anticancer	synthetic construct [Synthetic]	YES
5118	MYP_095769	XKXXKXXKX	NOT STANDARD	Anticancer Antimicrobial Antifungal	not reported [other]	NO
5119	MYP_095771	LPPYVPPXFV	NOT STANDARD	Antimicrobial Anticancer	Phakellia costata [Animal]	YES
5120	MYP_095775	GLWRALWRLLRSLWRLLWSQPKKKRKV	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO