FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 252 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5021	MYP_093858	DILTFEHYWAQLTS	STANDARD	Anticancer	not reported [other]	NO
5022	MYP_093896	HIGAFVANHGIPFVND	STANDARD	Neuropeptide	Cimex lectularius [Animal]	YES
5023	MYP_093927	FALALKKALKALKKAL	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
5024	MYP_093958	RWRRPWRRRPIRPPFYR	STANDARD	Cytotoxic Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
5025	MYP_093984	VAKKLAKLAKKLLAL	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
5026	MYP_094011	FKARRWQWRMKKLGAFKARRWQWRMKKLGAKX	NOT STANDARD	Antimicrobial Anticancer	Bos taurus [Animal]	YES
5027	MYP_094035	MRPEIWFAQEADRAGDEFNAYYARRVX	NOT STANDARD	Mcl-1/Bcl-xL binding BH3-domain mimetic Peptide-protein interaction Protein-binding Apoptosis regulation Anticancer-related	synthetic construct [Synthetic]	YES
5028	MYP_094072	IKIRIKIRIKIR	STANDARD	Antimicrobial Anticancer Hemolytic	cationic amphiphilic peptides [other]	NO
5029	MYP_094080	FLPKLLAGLPSFLCLVFKKC	STANDARD	Hemolytic	synthetic construct [Synthetic]	YES
5030	MYP_094097	MRPEIWAAQEFDRFGDENNAYYARRVX	NOT STANDARD	Mcl-1/Bcl-xL binding BH3-domain mimetic Peptide-protein interaction Protein-binding Apoptosis regulation Anticancer-related	synthetic construct [Synthetic]	YES
5031	MYP_094166	GIGGKILSGLKTALKGAAKELASTYLH	STANDARD	Anticancer	not reported [other]	NO
5032	MYP_094203	RSMRLSFRARGYGFR	STANDARD	Antimicrobial Antifungal	Bos taurus [Animal]	YES
5033	MYP_094210	PAWAKAFRAA	STANDARD	Anticancer	not reported [other]	NO
5034	MYP_094246	RWRWWWRVY	STANDARD	Antimicrobial Antimycobacterial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
5035	MYP_094253	LW	STANDARD	Antihypertensive ACE inhibitory	not reported [other]	NO
5036	MYP_094257	TDLGAM	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
5037	MYP_094272	GLQHWVPEL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
5038	MYP_094321	FVSTSDIKSM	STANDARD	Anticancer	Homo sapiens [Animal]	NO
5039	MYP_094366	MRPEIWAAQEADRNGDENNAYYARRVX	NOT STANDARD	Mcl-1/Bcl-xL binding BH3-domain mimetic Peptide-protein interaction Protein-binding Apoptosis regulation Anticancer-related	synthetic construct [Synthetic]	YES
5040	MYP_094372	CVLNGRMEC	STANDARD	Tumor-homing peptide Tumor vasculature targeting Aminopeptidase N/CD13 binding Peptide-mediated drug delivery Anticancer-related	synthetic construct [Synthetic]	YES