FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 251 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
5001	MYP_093475	ATCDLLSGTGVKHSACAAHCLLRGNRGGYCNGRAICVCRN	STANDARD	Antibacterial Antimicrobial Anti-Gram-positive	not reported [other]	NO
5002	MYP_093499	WRAWAKIYHGVGKLLKGVGRW	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5003	MYP_093520	FLFSLIPSVIAGLVSAIRN	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Androctonus aeneas [Animal]	YES
5004	MYP_093539	ALWKTMLKKL	STANDARD	Antimicrobial Antibacterial	not reported [other]	NO
5005	MYP_093559	CTGAAGGTGCTGTCCCAGAT	STANDARD	Anticancer	not reported [other]	NO
5006	MYP_093570	QFDEPR	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
5007	MYP_093594	XVXPPVA	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
5008	MYP_093597	FLPILGNLLSGLL	STANDARD	Antimicrobial Antibacterial Anti-Gram-negative Anti-Gram-positive Anticancer	not reported [other]	NO
5009	MYP_093598	IKIWFQNRRMKWKK	STANDARD	Cell-penetrating peptide Cargo delivery	Drosophila melanogaster [Animal]	NO
5010	MYP_093616	QEQDVDLVQKY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5011	MYP_093623	RPRSALPRLLLP	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5012	MYP_093681	KKKKKKNKKLQQRGD	STANDARD	Cell-penetrating peptide Cargo delivery	not reported [other]	NO
5013	MYP_093692	PKKKRKVAGYLLGKINLKALAALAKKILPQMQQNVFQYPGAGMVPQGEANF	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	NO
5014	MYP_093700	XCRRLCYRNRCVTYCRGR	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Animalia [Animal]	NO
5015	MYP_093715	GLPVCGETCVGGTCNTPGCTCSWPVCTRN	STANDARD	Antimicrobial Antifungal Antibacterial Anti-Gram-positive Anti-Gram-negative	Oldenlandia affinis [Plant]	YES
5016	MYP_093720	PRPGAPLAGSWPGTS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
5017	MYP_093721	QASGNHHVW	STANDARD	Anticancer	Homo sapiens [Animal]	YES
5018	MYP_093742	SIFSLFKMGAKALGKTLLKQAGKAGAEYAACKATNQC	STANDARD	Antimicrobial Antibacterial Anticancer	Synthetic construct based on Hydrophylax bahuvistara [Synthetic]	YES
5019	MYP_093759	ASEAEMRLFY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
5020	MYP_093800	KWKLFKKIGIGAVLKVLTTG	STANDARD	Antibacterial	Xenopus laevis [Animal]	YES