FUNCTION: REGULATORY PEPTIDE

Found 4,634 peptides

Current Node: Regulatory peptide | Page 25 of 232

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Cell signaling / Growth factor signaling (235) Stimulation activity (92) Chemical communication (67) Activation activity (48) Receptor signaling modulation (4)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
481	MYP_017708	YGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ	STANDARD	Cell-Cell Communication Hormones	not reported [other]	YES
482	MYP_017753	DLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF	STANDARD	Hormone Endocrine Myotropic Receptor modulation	Homo sapiens [Animal]	NO
483	MYP_017839	ARGMT	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
484	MYP_017840	DIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
485	MYP_017843	TIAALLSPYSYSTTSVVTN	STANDARD	Metabolic	not reported [other]	NO
486	MYP_017892	HSDAVFTDNYTRLRKQMAVKKYLNSILN	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Vasoactive Vasodilator Cardiovascular Metabolic regulation Physiological regulation Receptor modulation	Sus scrofa [Animal]	YES
487	MYP_017985	RCKAVRPYKNGCRGIDDKHWNSQCKTSQTYVRALTSENNVRVG	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
488	MYP_017998	ALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY	STANDARD	Hormone	Bos taurus [Animal] [Animal]; Ovis aries [Animal]	NO
489	MYP_018011	HADGSFSDEMNTVLDTLATRDFINWLLQTKITD	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Receptor modulation	Canis lupus familiaris [Animal]	YES
490	MYP_018061	ATHFPHQVI	STANDARD	Antidiabetic	not reported [other]	NO
491	MYP_018087	LVNQHLCGSHLVEALYLVCGERGFFYTPKA	STANDARD	Hormone Metabolic	Didelphis virginiana [Animal]	YES
492	MYP_018112	LPVCSGGDCQTPLPELFDRV	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
493	MYP_018123	SFLWSVFWL	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
494	MYP_018136	SRPYSFGLG	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
495	MYP_018179	NYKKPKLAAAAAVALLPAVLLALLAP	STANDARD	Regulatory	not reported [other]	YES
496	MYP_018181	EMPFPKYP	STANDARD	Metabolic regulation Antidiabetic Glucose metabolism Type 2 diabetes-related Signaling peptide Regulatory peptide	not reported [other]	NO
497	MYP_018270	SRTRQFYGLM	STANDARD	Neuropeptide Immunomodulatory	Mus musculus [Animal]	NO
498	MYP_018308	SFRNGVGTGMKKTSFRRAKS	STANDARD	Neuropeptide Neuromodulator Receptor modulation Immunomodulatory ACE inhibitory	Bos taurus [Animal]	NO
499	MYP_018429	RSVEGASRMEKLLSSSNSPSSTPLGFLSQDHSVN	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation	Homarus americanus [Animal]	NO
500	MYP_018433	DCSQDCAKCSYRLVRPGDINFLACTLECEGQLPSFKIWETCKDLLQVSKPEFPWDNIDMYKDSSKQDESHLLA	STANDARD	Analgesic Pronociceptive Neuropeptide Neuromodulator Growth regulation Development regulation Receptor modulation	Rattus norvegicus [Animal]	NO