FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 246 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4901	MYP_091589	CKGGRAKDC	STANDARD	Adipose tissue homing peptide White adipose vasculature targeting Prohibitin binding Targeted tissue ablation Drug Delivery Vehicle	synthetic construct [Synthetic]	YES
4902	MYP_091624	DGGNTSTFSED	STANDARD	Anticancer	not reported [other]	NO
4903	MYP_091684	DDESEQFSYHLASFNAV	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
4904	MYP_091700	NRLRRREDFARIGIVVSKKVSKLAVTRNRFKRQLRALKQIVVLGDDL	STANDARD	Predicted bioactivity labels: Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
4905	MYP_091713	NNRACFRTSKGNPAECPYLG	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4906	MYP_091716	FKKLKKLFSKLWNWKGGRGD	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
4907	MYP_091722	CGGKDCERRFSRSDQLKRHQRRHTGVKPFQ	STANDARD	Cell-penetrating peptide Cargo delivery	not reported [other]	YES
4908	MYP_091772	WFQNRRMKWKK	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
4909	MYP_091803	GIPCAESCVYIPCTVTALLGCSCSDKVCYN	STANDARD	Antimicrobial Anticancer	medicinal herb Hybanthus enneaspermus [Plant]	YES
4910	MYP_091814	DDAXRRXRRXRRX	NOT STANDARD	Anticancer Antimicrobial Antifungal	not reported [other]	NO
4911	MYP_091829	FLSMIPHIVSGVAALAKHL	STANDARD	Antimicrobial Antibacterial Antiparasitic Antiprotozoal Antifungal	Phyllomedusa sauvagii [Animal]	YES
4912	MYP_091858	QLQGVNLTPCEK	STANDARD	Anticancer Cytotoxic	Amaranthus hypochondriacus [Plant]	YES
4913	MYP_091860	YRWRCKNQ	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
4914	MYP_091916	QSLEIISRY	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4915	MYP_091943	LLLLDVAPL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4916	MYP_091948	GLFDIVKKIAGHIAGSIG	STANDARD	Antimicrobial Antibacterial Anticancer	Litoria aurea [Animal]; Litoria raniformis [Animal]	YES
4917	MYP_091952	GLPCVGETCVGGTCNTPGCSCSWPVCTRN	STANDARD	Anticancer	not reported [other]	NO
4918	MYP_091958	XCYWKVCT	NOT STANDARD	Somatostatin receptor agonist Antisecretory Anti-proliferative	Homo sapiens [Animal]; synthetic construct [Synthetic]	NO
4919	MYP_091973	KXXLKXXLK	NOT STANDARD	Antimicrobial Antibacterial Anticancer	not reported [other]	NO
4920	MYP_092011	KILGVSKRILTGKK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES