FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 245 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4881	MYP_091385	CKSCNGRCLA	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4882	MYP_091390	FLKGIVGMLGKLE	STANDARD	Antimicrobial Anticancer	Pelophylax saharicus [Animal]	NO
4883	MYP_091394	GLFDVIAKVASVIKKL	STANDARD	Anticancer	Amphibian skin [Animal]	NO
4884	MYP_091396	MRPEIWFAQEIRRIGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
4885	MYP_091401	GLWNSIKIA	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Antifungal Anti-Gram-negative	not reported [other]	NO
4886	MYP_091457	AEGEFGWWGDSHWLQYEGDPAK	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4887	MYP_091461	GIRKWFKKAAHVGKKVGKVALNAYL	STANDARD	Anticancer Toxic Hemolytic	not reported [other]	NO
4888	MYP_091468	MRPEIWIAQELDRFGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
4889	MYP_091491	CGAISLAKLQINES	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
4890	MYP_091494	VARGWKRKCPLFGKGGVARGWKRKCPLFGKGG	STANDARD	Anticancer	not reported [other]	NO
4891	MYP_091497	MPLLENLYL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4892	MYP_091500	DPARYEFLW	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	NO
4893	MYP_091505	TLNINRLILPRT	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4894	MYP_091521	FAKGVGKVGKKAL	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
4895	MYP_091536	VLPDIETLIGV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4896	MYP_091543	CGKRK	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4897	MYP_091547	VPLDCVLYR	STANDARD	Anticancer	Homo sapiens [Animal]	NO
4898	MYP_091573	GGGWGQPHGGG	STANDARD	Antimicrobial Anticancer Antiviral	Bos taurus [Animal]	NO
4899	MYP_091574	GVKKKWKKKLGLKLWLKISGVVLG	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4900	MYP_091586	WLKKLLKWL	STANDARD	Predicted bioactivity labels: Antibacterial Anti-Gram-positive Anticancer Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO