FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 242 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4821	MYP_090056	SHETVIIEL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4822	MYP_090074	LRRLLRRLLRRL	STANDARD	Anticancer Antimicrobial Antifungal	synthetic construct [Synthetic]	NO
4823	MYP_090081	HG	STANDARD	Antihypertensive ACE inhibitory Enzyme inhibitory	not reported [other]	YES
4824	MYP_090086	GLLKKLLKKLLKKL	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
4825	MYP_090126	MRPEIWIAQEADRDGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
4826	MYP_090129	XGLXGGLXRIX	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
4827	MYP_090131	RVAGSMSSL	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
4828	MYP_090133	CETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC	STANDARD	Anticancer Cytotoxic	Persea americana var. drymifolia [Plant]	YES
4829	MYP_090144	DYVREHKDNI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4830	MYP_090163	AWPENPSRRPF	STANDARD	Anticancer	not reported [other]	NO
4831	MYP_090164	MRPEIWAAQELDRDGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
4832	MYP_090181	RVKLVNLXFAALREXVP	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4833	MYP_090186	PLLENVISK	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4834	MYP_090250	KWXKK	NOT STANDARD	Anticancer	not reported [other]	NO
4835	MYP_090300	KVKDTPGLGK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4836	MYP_090396	ARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCAN	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Homo sapiens [Animal]	YES
4837	MYP_090415	HHHHHHTKRRITPKDVIDVRSVTTEINT	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	NO
4838	MYP_090416	SGHGAVHGVM	STANDARD	Immunomodulatory Antiviral Antitumor	synthetic construct [Synthetic]	NO
4839	MYP_090423	WYXNFEXLLR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
4840	MYP_090432	FALALKALKKL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	NO