FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 24 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
461	MYP_008509	LKLLKKLLKKLLKLL	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
462	MYP_008568	YGFVMPRSGLWFR	STANDARD	Antimicrobial Anticancer	Spirulina [other]	YES
463	MYP_008609	MRPEIWIAQEFRRAGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
464	MYP_008627	KVNHAACAAHCLLKRKRGGYCNKRRICVCRN	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
465	MYP_008636	GFGCPNDYPCHRHCKSIPGRCGGYCGGWHRLRCTCYR	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
466	MYP_008652	FHG	STANDARD	Antihypertensive ACE inhibitory	synthetic construct [Synthetic]	YES
467	MYP_008676	WGRAFRRLVRRLARGLRR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Antifungal	Synthetic construct [Synthetic]	YES
468	MYP_008690	GYCFTACRLRNGVRICYRRCN	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
469	MYP_008692	FKKLKKLFSKLWNWKRKKRRQRRR	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
470	MYP_008701	GDVWLFLTSTSHFAR	STANDARD	Anticancer	not reported [other]	NO
471	MYP_008754	CSDWQHPWC	STANDARD	Anticancer	not reported [other]	NO
472	MYP_008769	SILLRDAGLV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
473	MYP_008775	RWFKIQLQIRRWKNKK	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Hemolytic	synthetic construct [Synthetic]	YES
474	MYP_008787	QSHLSLCRWC	STANDARD	Anticancer	not reported [other]	NO
475	MYP_008791	PSTNHAL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
476	MYP_008799	HSHRDFQPVLHLVALNSPLSGGMRG	STANDARD	Antimicrobial Anticancer Hemolytic	Human endostatin [Animal]	YES
477	MYP_008821	GPWERCTAQCGGGIQARRR	STANDARD	Antimicrobial Anticancer Hemolytic	Homo sapiens [Animal]	YES
478	MYP_008841	GICRCICGRGICRCICGR	STANDARD	Antimicrobial Antiviral	not reported [other]	YES
479	MYP_008854	LKLLKFKKLQ	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
480	MYP_008870	LKKLAKLALAF	STANDARD	Anticancer	synthetic construct [Synthetic]	NO