FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 227 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4521	MYP_085018	LPNFCMDTSGRAGPLCMGSE	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4522	MYP_085027	MRPEIWFAQEFDRFGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
4523	MYP_085035	MRPEIWFAQEADRIGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
4524	MYP_085075	GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ	STANDARD	Antimicrobial Antifungal Antiviral Anticancer Antibacterial	Mus musculus [Animal]	YES
4525	MYP_085077	AIKKFGPLAKIVAKV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
4526	MYP_085086	NLYYASW	STANDARD	Anticancer	not reported [other]	NO
4527	MYP_085097	KKLIKVFAKGFKKAKKLWKGIG	STANDARD	Hemolytic	synthetic construct [Synthetic]	YES
4528	MYP_085112	DXWPLAXEALXR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
4529	MYP_085116	LALERRSGWLRLFGLKPRRKH	STANDARD	Antimicrobial Antibacterial Antifungal	Rana zhenhaiensis [Animal]	NO
4530	MYP_085125	YSMECFQFM	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4531	MYP_085135	NLVKQKPQI	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4532	MYP_085146	FVSALCMFL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
4533	MYP_085156	SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVY	STANDARD	Antimicrobial Antifungal Antibacterial	Acipenser gueldenstaedtii [Animal]	YES
4534	MYP_085171	ASVVKKLTKGVAGLLK	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
4535	MYP_085174	NACESAICG	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4536	MYP_085177	MPMAGDMNGL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4537	MYP_085187	WPLHTSVYPPSP	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4538	MYP_085241	FAKLWAKLAKKL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
4539	MYP_085300	SGFAP	STANDARD	Anticancer	not reported [other]	NO
4540	MYP_085305	FKKLKKLFSKLWNWK	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES