FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 222 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4421	MYP_083000	NYAENILTI	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4422	MYP_083015	GKWSKILGKLIR	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
4423	MYP_083022	GVIDAAKKVVNVLKNLF	STANDARD	Antimicrobial Anti-Gram-negative Anti-Gram-positive Non-hemolytic	Uperoleia mjobergii [Animal]	NO
4424	MYP_083034	ILGKIWKGLVSDF	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
4425	MYP_083048	VNWKKLLGKLLKVVK	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
4426	MYP_083059	FKCRRWQWRWKKLGAPSITCVRRAF	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
4427	MYP_083077	TTREKNL	STANDARD	Anticancer	not reported [other]	NO
4428	MYP_083091	MWQRPSSWIEGRLLTHTISRIAVSYQTKVNLL	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
4429	MYP_083106	GFNEIVQDIEDFLQNLV	STANDARD	Antimicrobial Antiviral Cytotoxic	synthetic construct [Synthetic]	NO
4430	MYP_083173	CGLILQKNEC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4431	MYP_083219	FLYNLLTRV	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
4432	MYP_083249	RFRRPIRRRPIRPPWYR	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
4433	MYP_083272	ILKKWWKKVKGLLGKLLGGVKSVIKGLNNI	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4434	MYP_083275	FFGTALKIAANILPTAICKILKKC	STANDARD	Antimicrobial Antibacterial Antifungal Toxic Anti-Gram-positive Cytotoxic Anti-Gram-negative	not reported [other]	NO
4435	MYP_083304	APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Struthio camelus [Animal]	YES
4436	MYP_083313	RRWFWRRRRWFWRR	STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	NO
4437	MYP_083322	AAYAAAKAAALAA	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
4438	MYP_083374	DLLSHAFFA	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4439	MYP_083375	GIGKFLKKAKKGIGAVLKVLTTGL	STANDARD	Anticancer Antimicrobial Antibacterial	not reported [other]	NO
4440	MYP_083448	IPLLRKGKKIIWW	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES