FUNCTION: BINDING / MOLECULAR INTERACTION

Found 5,826 peptides

Current Node: Binding / Molecular interaction | Page 221 of 292

Level 2 Subcategories

Binding activity (5389) Protein-protein interaction (5000) Metal binding (64) Metal-binding peptide (59) Receptor/ligand interaction (32) Cell adhesion (27) Calcium binding (26) Surface glycoprotein binding (1) Carbohydrate-binding peptide (0) Metal-binding / iron acquisition (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4401	MYP_134155	DAEKLVFFAE	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4402	MYP_134179	SLIPPKYIT	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4403	MYP_134219	TVFTSWEEYLDWVMPWNLVRIGLL	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4404	MYP_134232	PRRNLPAM	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4405	MYP_134283	MKVKQLVDKVEELLSKNYHLVNEVARLVKLVGER	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4406	MYP_134311	TKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGG	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4407	MYP_134334	RRKQKTGHAVRAIGRLSS	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4408	MYP_134339	WFH	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4409	MYP_134349	GLYASKLA	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4410	MYP_134436	VTLRRRMLAAAAERRLQK	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4411	MYP_134467	HGPEENEYK	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4412	MYP_134501	SFLQRSDPT	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4413	MYP_134507	SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS	STANDARD	Cytokine Growth factor intercrine beta (chemokine CC) family Chemoattractant Chemokine-like Growth factor signaling Angiogenic Heparin-binding	Homo sapiens [Animal]	YES
4414	MYP_134530	AADPLGQALRAIGDEFETRFR	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4415	MYP_134600	IAQLRRGDENAY	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4416	MYP_134616	GPAGPPGA	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4417	MYP_134649	SQFDLSTRRLK	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4418	MYP_134676	GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4419	MYP_134699	YTSGPGIRY	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES
4420	MYP_134702	KQYDREFLLDFQFM	STANDARD	Protein-binding Peptide-protein interaction Structural binding	not reported [other]	YES