FUNCTION: REGULATORY PEPTIDE

Found 4,634 peptides

Current Node: Regulatory peptide | Page 220 of 232

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Cell signaling / Growth factor signaling (235) Stimulation activity (92) Chemical communication (67) Activation activity (48) Receptor signaling modulation (4)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4381	MYP_165247	HKEDTLAFSEWGSPHAAVPR	STANDARD	Cell-Cell Communication	not reported [other]	YES
4382	MYP_165271	SAGATANLPLRS	STANDARD	Neuropeptide	Homo sapiens [Animal]	NO
4383	MYP_165273	PDERRQLNKIFLWDFCNSDSI	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
4384	MYP_165322	SVPHFSEEEKEPE	STANDARD	Cell-Cell Communication	not reported [other]	YES
4385	MYP_165331	FVFAEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPS	STANDARD	Antihyperglycemic Metabolic regulation	synthetic construct [Synthetic]	YES
4386	MYP_165393	DGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLM	STANDARD	Analgesic Pronociceptive Neuropeptide Neuromodulator Vasoactive Vasodilator Cardiovascular Receptor modulation	Homo sapiens [Animal]	YES
4387	MYP_165395	GIVEQCCHRKCSIYDMENYCN	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation	Lampetra fluviatilis [Animal]	YES
4388	MYP_165425	AVITGACDRDVQCGSGTCCAASLWSRNIRFCVPLGNNGEECHPASHKVPYNGKRLSSLCPCKSGLTCSKSGEKFQCS	STANDARD	Analgesic Pronociceptive Neuropeptide Neuromodulator Myotropic Receptor modulation Immunomodulatory	Bombina maxima [Animal]	YES
4389	MYP_165427	GGLLMSRKHKWKLSGVERANSVTW	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
4390	MYP_165520	ASGGMRNALVRF	STANDARD	Neuropeptide	not reported [other]	YES
4391	MYP_165521	YTFLNFMSNVGDP	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
4392	MYP_165531	SNGTTPGNYTNAERSIHNMLRCLRKNEPIIKFRKLTLPSNCTRYVSAVVENWKPEGV	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
4393	MYP_165609	TVIIEQSWGSPKVTKDGVTV	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
4394	MYP_165639	APKLSDGAAAGYVTKA	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
4395	MYP_165642	AIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCI	STANDARD	Cytokine Growth factor granulin family Growth factor signaling	Homo sapiens [Animal]	YES
4396	MYP_165664	VCNPIISGLYQGAGGPGPGG	STANDARD	Metabolic	not reported [other]	NO
4397	MYP_165672	RVGDGCFGLKLDRIGSMSGLGC	STANDARD	Hormone Endocrine Vasoactive Vasodilator Cardiovascular Enzyme modulation Ion channel modulation ACE inhibitory	Lachesis muta muta [Animal]	YES
4398	MYP_165686	WSKMDQLA	STANDARD	Antimicrobial Anti-Gram-negative Antibacterial Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Myotropic Receptor modulation Immunomodulatory	Homo sapiens [Animal]	YES
4399	MYP_165723	AFIKATGKKEDE	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
4400	MYP_165733	CANPDWIHI	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO