FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 217 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4321	MYP_081183	XLLKRIKTLL	NOT STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
4322	MYP_081190	GRWRRRWRG	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
4323	MYP_081205	WKLFDDGV	STANDARD	Antimicrobial Antibacterial Anticancer Antitumor Anti-Gram-positive Anti-Gram-negative	Cycas revoluta [Plant]	YES
4324	MYP_081256	ILAKLLSTAAGLLSNL	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
4325	MYP_081285	RFRPPIRRPPIRPPWYP	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	NO
4326	MYP_081290	KILRGVSKKIMRTFLRRILTGKK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
4327	MYP_081306	GLPVCGETCVGGTCNTPGCTCSWPKCTRN	STANDARD	Antimicrobial Anticancer	Protein derived [Animal]	NO
4328	MYP_081311	KKWWKKWXK	NOT STANDARD	Antimicrobial Anticancer	not reported [other]	NO
4329	MYP_081337	YERNSYKKFFLR	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	NO
4330	MYP_081355	KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL	STANDARD	Antimicrobial Antibacterial Lytic	Antheraea pernyi [Animal]	NO
4331	MYP_081408	CNNVGSYC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4332	MYP_081437	GTLPCESCVWIPCISSVVGCSCKSKVCYKN	STANDARD	Antimicrobial	Viola odorata [Plant]	NO
4333	MYP_081450	FAKLFAKLAK	STANDARD	Anticancer	not reported [other]	NO
4334	MYP_081478	AGRLQKVFKVIAK	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
4335	MYP_081485	GIPCGESCVWIPCITSAIGCSCKSKVCYRN	STANDARD	Antimicrobial	Viola biflora [Plant]; Viola tricolor [Plant]	NO
4336	MYP_081486	RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV	STANDARD	Anticancer	not reported [other]	NO
4337	MYP_081490	KKWWKKWWK	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
4338	MYP_081493	YPHYSLPGSSTL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
4339	MYP_081498	FALLKALLKKAL	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
4340	MYP_081506	VRRFPWWWPFLRRK	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO