FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 205 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4081	MYP_077026	YGRRARRRRRR	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4082	MYP_077029	XAIX	NOT STANDARD	Antiviral	Aspergillus terreus SCSGAF0162 [Fungus]	NO
4083	MYP_077035	LVTRTNICIHQ	STANDARD	Anticancer	not reported [other]	NO
4084	MYP_077038	FLFKLIPKAIKGLLKAFK	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
4085	MYP_077055	FLGWLFKWASK	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
4086	MYP_077072	KVKVKVKVXPTKVKVKVK	NOT STANDARD	Anticancer Antimicrobial	not reported [other]	NO
4087	MYP_077102	KKLLKFLKKQ	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
4088	MYP_077119	FALALKALKK	STANDARD	Anticancer	not reported [other]	NO
4089	MYP_077121	GYPMYPLPR	STANDARD	Anti-analgesic Antiamnestic Anticancer Cytotoxic Immunomodulatory Neuropeptide Opioid antagonist Smooth-muscles-contracting-peptide	Oryza sativa [Plant]	NO
4090	MYP_077125	FLLLIPRKIVTAL	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
4091	MYP_077127	VDKPPYLPRPKPPRRIYNR	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	NO
4092	MYP_077133	PYVPLILP	STANDARD	Anticancer Toxin	not reported [other]	NO
4093	MYP_077148	KLLRLLKKLLRLLLK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
4094	MYP_077151	DDDDDNDKIPDDRDN	STANDARD	Protein-binding FGF2-binding Anti-angiogenic template	Homo sapiens [Animal]	YES
4095	MYP_077164	ATYDGKCYKKDNICKYKAQSGKTAICKCYVKVCPRDGAKCEFDSYKGKCYC	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Antiviral Antifungal	Aspergillus clavatus [Fungus]	NO
4096	MYP_077198	GGYGPFP	STANDARD	Antibacterial Anti-Gram-positive Anticancer Antimicrobial Cytotoxic Toxin-related activity	not reported [other]	NO
4097	MYP_077200	KTWGQYWQV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4098	MYP_077207	GLGPGFSSY	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
4099	MYP_077225	LAGGTFDV	STANDARD	Anticancer	Homo sapiens [Animal]	NO
4100	MYP_077229	GSPQCPGGFNCPRCDCGAGY	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO