FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 203 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4041	MYP_076469	GETFDKLKEKLKTFYQKLVEKAEDLKGDLKAKLS	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Lachesana tarabaevi [Animal]	YES
4042	MYP_076473	GKWKSLLKHILK	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
4043	MYP_076496	LMAQEALAFL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
4044	MYP_076516	WFKKIPKFLHLLKKF	STANDARD	Antimicrobial Antibacterial Anticancer Toxic Hemolytic	not reported [other]	NO
4045	MYP_076524	GYCFTACYARNGVRICYRRCN	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
4046	MYP_076528	FSFKRLKGFAKKLWNSKLARKIRTKGLKYVKNFAKDMLSEGEEAPPAAEPPVEAPQ	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Isometrus maculatus [Animal]	YES
4047	MYP_076536	APRAPRLML	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4048	MYP_076555	YHWYGYTPQNVIGGGLLKLLKKLLKKLLKL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
4049	MYP_076576	FGVLAKVAAHVVPAIAEHF	STANDARD	Antimicrobial	not reported [other]	NO
4050	MYP_076581	MRPEIWFAQEADRIGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
4051	MYP_076599	ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC	STANDARD	Antimicrobial	Petunia hybrida [Plant]; Insecta [Animal]	NO
4052	MYP_076600	RFRLPFRRPPIRIHPPPFYPPFRRFL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Capra hircus [Animal]	NO
4053	MYP_076607	X	NOT STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
4054	MYP_076625	IPLVVPLRRRRRRRRC	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
4055	MYP_076644	CTAMRNTDC	STANDARD	Anticancer	not reported [other]	NO
4056	MYP_076661	SASLHPATV	STANDARD	Anticancer	Homo sapiens [Animal]	YES
4057	MYP_076667	QSQQTFNNLWKLLNQN	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	NO
4058	MYP_076669	SQETFSDLWK	STANDARD	Anticancer	not reported [other]	NO
4059	MYP_076688	WRTWRT	STANDARD	Antibacterial Anti-Gram-positive Anticancer Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
4060	MYP_076729	ALLALTSAV	STANDARD	Anticancer	synthetic construct [Synthetic]	NO