FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 202 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
4021	MYP_151117	CDSYTYCPDGTTCCRHPQGGWTCCPYSPGKCCLDGYHCCPIGFDCDRTYQHC	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
4022	MYP_151228	DYRTFRRRRPVHN	STANDARD	Growth regulation Development regulation	Arabidopsis thaliana [Plant]	NO
4023	MYP_151294	SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS	STANDARD	Cytokine Growth factor intercrine alpha (chemokine CxC) family Chemokine-like Growth factor signaling Angiogenic	Homo sapiens [Animal]	YES
4024	MYP_151321	FLFQPQRF	STANDARD	RFamide Neuropeptide Neuromodulator	Rattus norvegicus [Animal]	NO
4025	MYP_151328	LSKSVL	STANDARD	Metabolic regulation Antidiabetic Glucose metabolism Type 2 diabetes-related Signaling peptide Regulatory peptide	not reported [other]	NO
4026	MYP_151338	ASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEED	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
4027	MYP_151340	APGYSHSFV	STANDARD	Neuropeptide	Aplysia kurodai [Animal]; Aplysia californica [Animal]	NO
4028	MYP_151365	EDLQVGQVELGGGPGAG	STANDARD	Metabolic	not reported [other]	NO
4029	MYP_151480	DLEGCRLGWVGHCNVWGGDEYTKRTSHSVPPSHKSKLL	STANDARD	Stimulatory	synthetic construct [Synthetic]	YES
4030	MYP_151604	GVFAEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPS	STANDARD	Antihyperglycemic Metabolic regulation	synthetic construct [Synthetic]	YES
4031	MYP_151648	QNSPFXIFGAWA	NOT STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
4032	MYP_151652	GLF	STANDARD	Immunomodulatory Immunoregulator Regulatory	synthetic construct [Synthetic]	YES
4033	MYP_151655	SPKMVQGSGCFGRKMDRISSSSGLGCKV	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Vasoactive Vasodilator Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory	Homo sapiens [Animal]	NO
4034	MYP_151681	SELRCQCLTTLPRVDFKNIQ	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
4035	MYP_151703	GXFAEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPS	NOT STANDARD	Antihyperglycemic Metabolic regulation	synthetic construct [Synthetic]	YES
4036	MYP_151715	GERGFFYT	STANDARD	Metabolic	not reported [other]	NO
4037	MYP_151737	SVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNFVALGASIVHRDGGSQRPRKKEDNVLVESHQKSLGEADKAAVDVLIKAKPQ	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory	Sus scrofa [Animal]	YES
4038	MYP_151744	HAEYERHADGRYTSDISSYLEGQAAKEFIAWLVNGRG	STANDARD	Hormone Metabolic	Heloderma suspectum [Animal]	NO
4039	MYP_151747	SVDQDLGPEVPPENVLGALLRVKRLENPSPQAPARRLLPP	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Enzyme modulation Ion channel modulation ACE inhibitory	Mus musculus [Animal]	YES
4040	MYP_151756	GIVEQCCHKRCSIYDLENYCN	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation	Myxine glutinosa [Animal]	YES