FUNCTION: ANTICANCER

Found 13,621 peptides

Current Node: Anticancer | Page 20 of 682

Level 2 Subcategories

Cytotoxic anticancer activity (8360) Tumor Homing Peptide (659) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (27) tumor necrosis factor family (19) Anti-breast cancer (9) Prostate cancer targeting (2) Anti-angiogenic activity (1) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
381	MYP_004685	RICCYPNVWCCD	STANDARD	Toxic Cytotoxic	not reported [other]	NO
382	MYP_004711	LVPWPFPT	STANDARD	Anticancer Antibacterial Antimicrobial	not reported [other]	NO
383	MYP_004740	LNQEEARKSE	STANDARD	Antimicrobial Anticancer	not reported [other]	NO
384	MYP_004777	FAKLLAKLAKKFAL	STANDARD	Anticancer	not reported [other]	NO
385	MYP_004786	GIKRGIIKRIKRIKRI	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
386	MYP_004805	KKLFKKILKEL	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
387	MYP_004824	LRLLTPAQFKRLGLTVAKRYVKRANQRNRIKRVIRDIDIVVLNKLI	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
388	MYP_004825	KAKFKAD	STANDARD	Toxic Cytotoxic	not reported [other]	YES
389	MYP_004827	GKWMSLLKHILK	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
390	MYP_004829	DDCIKPYGFCSLPILKNGLCCSGACVGVCADLP	STANDARD	Toxic Cytotoxic	not reported [other]	YES
391	MYP_004830	KGRKKRRQRRRPPQ	STANDARD	Cell-penetrating peptide Cargo delivery	Human immunodeficiency virus 1 [Virus]	YES
392	MYP_004842	LKKLCRIAKKLCRI	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
393	MYP_004846	CRGDKGPEC	STANDARD	Anticancer	not reported [other]	NO
394	MYP_004847	FAKKLAKKLKKLAKLALAL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
395	MYP_004903	DSLKSYWYLQKFSWR	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
396	MYP_004921	LDIVKKVVGAFGSL	STANDARD	Antimicrobial Antibacterial Anticancer	Litoria raniformis [Animal]	YES
397	MYP_004935	FARLQFTYNHIQRHVRDMEGR	STANDARD	Toxin-related activity Antibacterial Antimicrobial Antiviral	not reported [other]	NO
398	MYP_004938	XXX	NOT STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
399	MYP_004943	ILPWKKPWEPWRR	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Antifungal Anti-Gram-negative	not reported [other]	NO
400	MYP_004954	GIIKKIIKKIIKKA	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES