FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 2 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
21	MYP_000381	MRPEIWIAQELRRFGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
22	MYP_000410	XRARARKRRRRXFXKX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
23	MYP_000428	XXGXGXXXA	NOT STANDARD	Antimicrobial Anticancer	Lyngbya majuscula [Bacterium]	YES
24	MYP_000446	PKKKRKVWKLLQQFFGLM	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
25	MYP_000461	XIIFPXPLPINAI	NOT STANDARD	Antimicrobial Anticancer	not reported [other]	YES
26	MYP_000564	GIFKVLKNLAKGVITSLAS	STANDARD	Antimicrobial Antifungal Anticancer	synthetic construct [Synthetic]	YES
27	MYP_000588	RIPLEM	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
28	MYP_000592	YGRKKRRQRR	STANDARD	Anticancer	not reported [other]	NO
29	MYP_000599	LLALLMAGL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
30	MYP_000608	GWFKKTFHKVSHAVKSGIHA	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
31	MYP_000610	GIMSSLMKKAAAHIAK	STANDARD	Antimicrobial Anticancer	AMP [other]	YES
32	MYP_000658	IALNFPGSQK	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
33	MYP_000674	XGLFGXGRKKRRQRRRPPQ	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Protein derived [Animal]	YES
34	MYP_000689	RQIKIQFQNRRMKWKKKAYARIGNSYFK	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
35	MYP_000694	APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPWIARMWRT	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive	Enterococcus faecalis [Bacterium]	YES
36	MYP_000711	KRWRWRW	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
37	MYP_000715	RQIAIWFQNRRMKWKK	STANDARD	Cell-penetrating peptide	Drosophila melanogaster [Animal]	YES
38	MYP_000716	IGGYCSWLRL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Harmonia axyridis [Animal]	YES
39	MYP_000743	XNIIXPLLXXIC	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
40	MYP_000772	LTLRWVGLMS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES