FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 194 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3861	MYP_072649	LLDGTATLRL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3862	MYP_072672	FLGALWKALSKLL	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
3863	MYP_072731	QLPVEEPNP	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3864	MYP_072733	LTVQPWP	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3865	MYP_072745	MRPEIWAAQELRRAGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	NO
3866	MYP_072763	RFRRFRLPFRRIHPPPFVRIHPPPFYRRFL	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
3867	MYP_072764	GRKKKKK	STANDARD	Insecticidal Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Antifungal Anti-Gram-negative	not reported [other]	NO
3868	MYP_072792	KWXSFLXTFXSLKXTVLHTLLXAISS	NOT STANDARD	Anticancer Toxic Hemolytic	not reported [other]	NO
3869	MYP_072818	GPSGNLHIRPAS	STANDARD	Anticancer	not reported [other]	NO
3870	MYP_072907	XLPICGETCVLGRCYTPNCRCQYPICVR	NOT STANDARD	Antimicrobial Antibacterial Antifungal	Steinchisma laxum [Plant]	NO
3871	MYP_072915	CPIRPMEDC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3872	MYP_072917	LALALALALALALALAKLAKLAKLAKLAKLAKKIK	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	NO
3873	MYP_072948	MKIQLFFFILHFWVTILPARSNFEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
3874	MYP_072994	RAGLQFPVGR	STANDARD	Anticancer	not reported [other]	NO
3875	MYP_073044	MRPEIWIAQELDRDGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
3876	MYP_073086	VPNTNSLPAAVN	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3877	MYP_073092	SYEVRSTF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3878	MYP_073101	AEEEIYGEFEAKKKK	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
3879	MYP_073109	MFSESTMRSLTILLVCVLTFSVFTVTVALPPRIIHHNTGHAYGCPDDYSRCQQHCSATFGWTGWCGGVTRGECKCRE	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
3880	MYP_073132	FSGSGSGSGRRRRRRRRGC	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO