FUNCTION: ENZYME MODULATION

Found 7,157 peptides

Current Node: Enzyme modulation | Page 193 of 358

Level 2 Subcategories

Enzyme inhibition (3665) Receptor tyrosine kinase inhibition (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3841	MYP_097173	DRVYI	STANDARD	Hormone Endocrine Vasoactive Vasoconstrictor Cardiovascular Reproductive regulator Growth regulation Development regulation Receptor modulation ACE inhibitory	Rattus norvegicus [Animal]	NO
3842	MYP_097199	MKTLRTLCVLMILSGVIFFGLKIDA	STANDARD	Protein secretion signal peptide Secretory expression optimization Cutinase secretion	Bacillus subtilis [Bacterium]	YES
3843	MYP_097216	QPLGYFK	STANDARD	DPP-IV inhibitory Enzyme inhibitory Antidiabetic	not reported [other]	NO
3844	MYP_097223	PKIDAMREKVLA	STANDARD	ACE inhibitory Enzyme inhibitory Antihypertensive	Ovis aries [Animal]	YES
3845	MYP_097294	GWWYKGRARPVSAVA	STANDARD	Entry inhibition Antiviral Entry inhibitor	synthetic construct [Synthetic]	YES
3846	MYP_097301	RFH	STANDARD	Antihypertensive	Actinopterygii [Animal]; Gallus gallus [Animal]	NO
3847	MYP_097310	IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLK	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory Feeding regulator	Sus scrofa [Animal]	NO
3848	MYP_097334	MDPVDPNIE	STANDARD	DPP-IV inhibitory Enzyme inhibitory Antidiabetic	not reported [other]	YES
3849	MYP_097335	VAVPV	STANDARD	DPP-IV inhibitory Enzyme inhibitory Antidiabetic	Triticum aestivum [Plant]	YES
3850	MYP_097345	MEKKSFPIARVIGIGVLGIAGMGILLLWLAVTLSDPASPGA	STANDARD	Protein secretion signal peptide Secretory expression optimization alpha-amylase (AmyE) secretion	Corynebacterium glutamicum R [Bacterium]	YES
3851	MYP_097353	KYPVEPFTES	STANDARD	ACE inhibitory Enzyme inhibitory Antihypertensive	not reported [other]	NO
3852	MYP_097385	KFHSGIQSEP	STANDARD	ACE inhibitory Enzyme inhibitory Antihypertensive	not reported [other]	NO
3853	MYP_097387	TTMPLW	STANDARD	Immunomodulatory	Bos taurus [Animal]	NO
3854	MYP_097450	MGLGKKLSVAVAASFMSLSISLPGVQA	STANDARD	Protein secretion signal peptide Secretory expression optimization Cutinase secretion	Bacillus subtilis [Bacterium]	YES
3855	MYP_097477	YSKFNFGL	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator	Helicoverpa armigera [Animal]	NO
3856	MYP_097480	FMVFMVPF	STANDARD	Enzyme inhibitory	Nephelium mutabile [Plant]	NO
3857	MYP_097490	FNW	STANDARD	ACE inhibitory Enzyme inhibitory Antihypertensive	not reported [other]	NO
3858	MYP_097500	AKY	STANDARD	ACE inhibitory Enzyme inhibitory Antihypertensive	Homarus americanus [Animal]	YES
3859	MYP_097517	GKGLW	STANDARD	Enzyme inhibitory ACE inhibitory Antihypertensive	Glycine max [Plant]	YES
3860	MYP_097529	XGWPGPKVPP	NOT STANDARD	Antihypertensive	not reported [other]	NO