FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 190 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3781	MYP_071184	TINPQVSKT	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3782	MYP_071214	GLFRALLRLLRSLWRLLLRA	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
3783	MYP_071226	RNLCWSKD	STANDARD	Antimicrobial Anticancer Hemolytic	TRAIL227-234 [other]	YES
3784	MYP_071236	KMWSKILGHLIR	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
3785	MYP_071250	DLGPPISLERLDVGTNLGNAIAKLEDAKELLESSD	STANDARD	Antimicrobial Antiviral	synthetic construct [Synthetic]	YES
3786	MYP_071251	ASVVKKLTKGVAKLLK	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
3787	MYP_071261	VDKPPYLPRPHPPRRIYNR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
3788	MYP_071263	THRPPMWSPVWP	STANDARD	Imaging	synthetic construct [Synthetic]	NO
3789	MYP_071271	WNWTKRF	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
3790	MYP_071285	TAWYANFEKLXR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
3791	MYP_071296	XGLXGKLXGIL	NOT STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
3792	MYP_071316	AEGEFLMWGGSHWLEYWYEGDPAK	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
3793	MYP_071342	LPVFSTLPFAYCNIHQVCH	STANDARD	Anti-angiogenic	Homo sapiens [Animal]	YES
3794	MYP_071347	MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCV	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
3795	MYP_071484	NETPVAVLTI	STANDARD	Anticancer	Homo sapiens [Animal]	NO
3796	MYP_071491	SAYGEPRKL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3797	MYP_071502	GFSSIFRGVAKFASKGLGKDLAKLGVDLVASKISKQS	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
3798	MYP_071524	VHMNCSWMRVSEGHPCESAD	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3799	MYP_071527	KELEATKQY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3800	MYP_071529	FAKLLAKLAKKAA	STANDARD	Anticancer	synthetic construct [Synthetic]	NO