FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 187 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3721	MYP_069951	ARLLKRKQFVKVGITVSKKFGKAHQRNRFKRIVRELQVVILSEELLQRI	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
3722	MYP_069977	EGSLGISHTR	STANDARD	Anticancer	Homo sapiens [Animal]	NO
3723	MYP_069984	CWWRLEGC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3724	MYP_069999	CXGRCLLIIKLAKLAKKLAKLAK	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
3725	MYP_070012	PQMVILQLERFIFRLVWRRH	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3726	MYP_070038	SFSIIHTPILPL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3727	MYP_070055	GIACGESCVFLGCFIPGCSCKSKVCYFN	STANDARD	Antimicrobial Anti-HIV Anticancer Cytotoxic	Psychotria leptothyrsa [Plant]	YES
3728	MYP_070088	GTEFTTVLY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3729	MYP_070100	RWFHFPGRWFHF	STANDARD	Anticancer Toxin-related activity Antibacterial Antimicrobial	not reported [other]	NO
3730	MYP_070133	GICKDDWCQ	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3731	MYP_070145	AKCIKNGKGCREDQGPPFCCSGFCYRQVGWARGYCKNR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Antifungal	Mesembryanthemum crystallinum [Plant]	NO
3732	MYP_070171	IPNWARQDL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3733	MYP_070210	GKWMSKLKHILK	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
3734	MYP_070232	VXKPPYLPRPRWXRXXYNX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
3735	MYP_070268	GIIKKIIKKI	STANDARD	Antimicrobial	synthetic construct [Synthetic]	YES
3736	MYP_070274	SHGKPPSFSPYT	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide Cancer cell targeting peptide	not reported [other]	YES
3737	MYP_070287	KRCSSSLCA	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
3738	MYP_070288	XXWDIPXXWWX	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
3739	MYP_070345	GKCSTRGRKCMRRKK	STANDARD	Antimicrobial Anticancer	Homo sapiens [Animal]	NO
3740	MYP_070368	GSYPQFMAPGLVLHITGTTRIGTDDQTSVADPTSK	STANDARD	Anticancer	synthetic construct [Synthetic]	NO