FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 186 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3701	MYP_069642	LVPFIGRTLGGLLARF	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Rana temporaria [Animal]	YES
3702	MYP_069649	GLLEALAELLEGRKKRRQRRRPPQ	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
3703	MYP_069665	GLLKRIKALL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
3704	MYP_069673	MRPEIWAAQEIRRAGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
3705	MYP_069693	MTRVQFKHHHHHHHPD	STANDARD	Histidine operon leader peptide Regulatory leader peptide Histidine biosynthesis attenuation	Escherichia coli [Bacterium]	NO
3706	MYP_069705	NTHMTAF	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3707	MYP_069710	GWWRRTVAAVRK	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
3708	MYP_069729	KAKLAKKALAKLL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
3709	MYP_069772	GLFDIVKKLV	STANDARD	Anticancer	not reported [other]	NO
3710	MYP_069775	LHRIDLGPPISLERLDVGTNLGNAIAKLEDAKELL	STANDARD	Antimicrobial Antiviral	synthetic construct [Synthetic]	YES
3711	MYP_069777	KFKKLAKKW	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3712	MYP_069785	WCRRYRVLVXX	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
3713	MYP_069814	ALXGVL	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Fungi [Fungus]	YES
3714	MYP_069823	ANDPQCLYGNVAAKF	STANDARD	Antimicrobial Antibacterial Antifungal Antiviral	Agrocybe cylindracea [Animal]	YES
3715	MYP_069834	KLFHDMNVSY	STANDARD	Anticancer	Homo sapiens [Animal]	NO
3716	MYP_069848	KWKLFKKIGIGRLLKRGLRKLLKLLR	STANDARD	Antimicrobial Anticancer	not reported [other]	NO
3717	MYP_069859	ILGPVLGLVSNALGGLIKKI	STANDARD	Antimicrobial Antibacterial	Bombina maxima [Animal]	YES
3718	MYP_069889	XGLXGGLXGI	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
3719	MYP_069910	KRMGIFHLFWAGLRKLGNLIKNKIQQGIENFLG	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Sarcophilus harrisii [Animal]	YES
3720	MYP_069920	EILSRRPAYRKIL	STANDARD	Anticancer	synthetic construct [Synthetic]	YES