FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 184 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3661	MYP_068982	LVFPIFPP	STANDARD	Anticancer Antibacterial Antimicrobial	not reported [other]	NO
3662	MYP_069025	AILALLPAL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3663	MYP_069036	MRPEIWFAQELRRAGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3664	MYP_069051	TSSSLNMAVRGGLTR	STANDARD	Anticancer	not reported [other]	NO
3665	MYP_069060	KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive	Pediococcus acidilactici [Bacterium]	YES
3666	MYP_069063	MRPEIWAAQELDRFGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
3667	MYP_069078	CSRPRRSVC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3668	MYP_069113	XACRGRGRRCGSGRRSCG	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3669	MYP_069116	KKWWRRVLSGLKTGPALSNV	STANDARD	Antimicrobial Anti-proliferative	not reported [other]	NO
3670	MYP_069122	GLFKVLGSVAKHLLPHVAPVIAEKL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	Litoria xanthomera [Animal]	YES
3671	MYP_069127	FLGWLFKWAWK	STANDARD	Anticancer Antimicrobial	synthetic construct [Synthetic]	YES
3672	MYP_069129	FAKKLAKKLKKLAKKLAKLAKKL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
3673	MYP_069153	ILKKWWKKVKGLLGKLLGGVKKVIKGLNNI	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3674	MYP_069181	QPFPFIFP	STANDARD	Antimicrobial Anticancer	Phakellia sp. [Animal]	YES
3675	MYP_069193	WYANLEKLXR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
3676	MYP_069237	TADGKTYYY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3677	MYP_069250	LRVRLASHLRKLRKRLLR	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
3678	MYP_069268	GLFDIAKKVI	STANDARD	Anticancer	not reported [other]	NO
3679	MYP_069295	PFRLRLRL	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
3680	MYP_069331	DDESEQFSYHLLAFNAV	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	NO