FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 181 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3601	MYP_067836	RSPADRRRRY	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3602	MYP_067842	ISLERLDVGTNLGNAIAKLEDAKELLESSDQILRS	STANDARD	Antiviral Anti-MeV Entry inhibition	synthetic construct [Synthetic]	YES
3603	MYP_067857	KEKIGKEFGGKTALKGA	STANDARD	Antimicrobial Antibacterial Anticancer	synthetic construct [Synthetic]	NO
3604	MYP_067872	DWXPLAFEALXR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
3605	MYP_067886	KKLKLFKLKQ	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
3606	MYP_067912	MTKCRG	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3607	MYP_067937	GIGKFLHSGGKNLKALAALAKKIL	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
3608	MYP_067967	FAKKLAKKLKKLAKKLAKLALALKALALKAL	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
3609	MYP_067998	FALGAVTKVLYKLFCLITRKC	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
3610	MYP_068015	CGESCVFIPCISSVIGCACKSKVCYKNGSIP	STANDARD	Cytotoxic	Viola philippica [Plant]	NO
3611	MYP_068032	KWCFRVCYRGICYSRCRG	STANDARD	Antimicrobial Anticancer	Tachypleus tridentatus [Animal]	YES
3612	MYP_068036	GYVPLWP	STANDARD	Antimicrobial Anticancer	Plantae [Plant]	NO
3613	MYP_068055	KTLTSVFQKK	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
3614	MYP_068063	KLLKLLKLKKLLKL	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
3615	MYP_068094	YMEHNNVYTV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3616	MYP_068105	RRWWRWVVW	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
3617	MYP_068117	LLRDAGLVKM	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3618	MYP_068134	RLARLALVL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3619	MYP_068141	ACDFQSCWVSCQRQYNIYFRRAYCEHSKCTCVYNYGG	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
3620	MYP_068143	FHIIGGLFSAGKAIHRLIRRRRR	STANDARD	Antibacterial Anti-Gram-positive Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO