FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 171 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3401	MYP_064146	FAKKLLAKALKL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
3402	MYP_064156	VLYPRVVRR	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3403	MYP_064161	VGSGGCMFGNGK	STANDARD	Anti-angiogenic	synthetic construct [Synthetic]	NO
3404	MYP_064183	VGALAVVVWLWLWLW	STANDARD	Antimicrobial Antibacterial Antiviral	Bacillus brevis [Bacterium]	NO
3405	MYP_064191	WYANXEKLLR	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
3406	MYP_064252	APYKSVTSL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3407	MYP_064262	HTDSLHLLI	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3408	MYP_064281	CKDDEDCQVFEKCC	STANDARD	Enzyme inhibitory	Pacifastacus leniusculus [Animal]	NO
3409	MYP_064284	FALGAVTKVLPKLFCLITRKC	STANDARD	Antimicrobial Antibacterial Antifungal	Amolops hainanensis [Animal]	YES
3410	MYP_064342	MRPEIWIAQELRRNGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
3411	MYP_064352	GSVLPVL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3412	MYP_064355	KLFEFLVYGV	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
3413	MYP_064377	QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY	STANDARD	Anticancer Immunotherapy Immune checkpoint inhibitor	Homo sapiens [Animal]	NO
3414	MYP_064413	EVEPEGFHYVSELSDGTYETAEGK	STANDARD	Antiparasitic Anticancer Antimicrobial Antibacterial Antifungal	not reported [other]	NO
3415	MYP_064422	TSCDPSLCE	STANDARD	Anticancer	not reported [other]	NO
3416	MYP_064426	GLFDIVKKVVGALGSL	STANDARD	Anticancer Antibacterial Antimicrobial Antifungal Anti-Gram-positive Anti-Gram-negative	not reported [other]	NO
3417	MYP_064435	FAKLLAKFLKKAL	STANDARD	Anticancer	synthetic construct [Synthetic]	YES
3418	MYP_064446	SILLRDAGL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3419	MYP_064483	GVIPCGESCVFIPCISSVVGCTCKNKVCYRN	STANDARD	Antimicrobial	Melicytus chathamicus [Plant]	NO
3420	MYP_064524	QFQSIYAKF	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO