FUNCTION: CARDIOVASCULAR

Found 3,999 peptides

Current Node: Cardiovascular | Page 170 of 200

Level 2 Subcategories

Blood pressure regulation (0) Vascular tone modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3381	MYP_147562	LEY	STANDARD	Antihypertensive ACE inhibitory	not reported [other]	NO
3382	MYP_147576	QVPQX	NOT STANDARD	Antihypertensive	not reported [other]	NO
3383	MYP_147594	LGPLGHQ	STANDARD	Enzyme inhibitory ACE inhibitory	Skin gelatin [Animal]	YES
3384	MYP_147624	SLPQ	STANDARD	Antihypertensive	Goat milk [Animal]; Bos taurus [Animal]	NO
3385	MYP_147650	YYAPFDGIL	STANDARD	Enzyme inhibitory Neuropeptide ACE inhibitory	Vitis vinofera [Plant]	YES
3386	MYP_147731	TTENVLFG	STANDARD	Antihypertensive ACE inhibitory	Agaricus bisporus [Fungus]	YES
3387	MYP_147739	GPAVFPAENGVQNTESTQE	STANDARD	Cell-Cell Communication	not reported [other]	NO
3388	MYP_147820	AEDQELESLSAIEAELEKVAHQLQAL	STANDARD	Antimicrobial Anti-Gram-negative Hormone Endocrine Vasoactive Vasoconstrictor Myotropic Receptor modulation Immunomodulatory	Mus musculus [Animal]	YES
3389	MYP_147848	VPKVKET	STANDARD	Antihypertensive	Ovis aries [Animal]	NO
3390	MYP_147882	AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Vasoactive Vasoconstrictor Cardiovascular Metabolic regulation Physiological regulation Receptor modulation	Rattus norvegicus [Animal]	NO
3391	MYP_147885	NAQRP	STANDARD	Enzyme inhibitory ACE inhibitory	Arachis hypogaea [Plant]	YES
3392	MYP_147962	SGSKTAEIGDGCFGVPIDHIGSTSGMGCGRPRPKP	STANDARD	Hormone Endocrine Vasoactive Vasodilator Cardiovascular Metabolic regulation Physiological regulation Enzyme modulation Ion channel modulation Receptor modulation ACE inhibitory	Pseudechis australis [Animal]	NO
3393	MYP_147970	PVKVYPNGAEDESAEAFPLEF	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator	Neogale vison [Animal]	YES
3394	MYP_148002	LLYQQPV	STANDARD	Antihypertensive ACE inhibitory Enzyme inhibitory	Bos taurus [Animal]	YES
3395	MYP_148025	QPQ	STANDARD	Antihypertensive	Bos taurus [Animal]	NO
3396	MYP_148027	EKERERQ	STANDARD	Antihypertensive ACE inhibitory Enzyme inhibitory	Sus scrofa [Animal]	YES
3397	MYP_148051	KPK	STANDARD	Antihypertensive	not reported [other]	NO
3398	MYP_148061	VLIVP	STANDARD	Antihypertensive ACE inhibitory Enzyme inhibitory	Glycine max [Plant]	YES
3399	MYP_148210	LR	STANDARD	Hypouricemic	not reported [other]	NO
3400	MYP_148227	SGAM	STANDARD	ACE inhibitory Antihypertensive Enzyme inhibitory	Phaseolus vulgaris [Plant]	NO