FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 168 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3341	MYP_062810	WDPYFAGVKKLTKAILGEIA	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
3342	MYP_062811	LLGDLLRKSKEKIGKEFKRIVQR	STANDARD	Antimicrobial Antiviral Cytotoxic Anticancer	synthetic construct [Synthetic]	YES
3343	MYP_062849	GFDCANESVL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3344	MYP_062892	CVWCNGRCGL	STANDARD	Anticancer	not reported [other]	NO
3345	MYP_062894	IMLCLIAAV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3346	MYP_062927	IIFGVIKALSG	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
3347	MYP_062949	FFGHLFKLATKIIPSLFQ	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Mesobuthus eupeus [Animal]	NO
3348	MYP_062954	KLALKLALKALKAALKLAGC	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
3349	MYP_062971	KILRGVSKKIMRRISKDILTGKK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
3350	MYP_062985	IELLQAR	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3351	MYP_063004	WRTWRTWRTWRT	STANDARD	Anticancer Toxin-related activity Antibacterial Antimicrobial	not reported [other]	NO
3352	MYP_063008	GFKQSSKAL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3353	MYP_063019	DLFGR	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
3354	MYP_063026	FSLVNADQTT	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
3355	MYP_063027	FPSPSKTSLTL	STANDARD	Anticancer	Homo sapiens [Animal]	NO
3356	MYP_063146	SDMVRFHLF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
3357	MYP_063150	ATCDLLSFDTKWGSLNHSACAAHCIALRKGYKGGRCYKQVCRCRK	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
3358	MYP_063153	VTEKLQPTY	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
3359	MYP_063160	ESLFRAVITK	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
3360	MYP_063184	SVTPIVCGETCFGGTCNTPGCSCSWPICTK	STANDARD	Antimicrobial	Psychotria leiocarpa [Plant]	NO