FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 165 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3281	MYP_122396	DKHGTKHDFLNLRRKYRRHNCPKKRCLPLHSRVPFP	STANDARD	Hormone Endocrine Cardiovascular Growth regulation Development regulation Myotropic Receptor modulation	Danio rerio [Animal]	YES
3282	MYP_122415	ANTNMFTYEIAPVFVLLE	STANDARD	Antidiabetic	not reported [other]	NO
3283	MYP_122421	RPGMLDFKGKAKWDAWNELKGTTKEDAMKAYISKVEELKKKYGI	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3284	MYP_122494	IIKTLNILTSRKNSCMELP	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
3285	MYP_122537	DRRDPRGIIGIGKKLFG	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
3286	MYP_122538	GQENPDAYRIQHFRWGEPLP	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3287	MYP_122583	KRYIEYPIRLDLGKGCDPRFPTAACYKRTPANPYRRPCTTANRCRRSTSSTRVPSLKTFVEIPPM	STANDARD	Hormone Endocrine Growth regulation Development regulation Receptor modulation ACE inhibitory	Arabidopsis thaliana [Plant]	YES
3288	MYP_122611	SLSAASAPLAETSTPLRL	STANDARD	Neuropeptide precursor Secretory peptide	Rattus norvegicus [Animal]	NO
3289	MYP_122645	CYIQNCPLG	STANDARD	Hormone	synthetic construct [Synthetic]	YES
3290	MYP_122674	GIVEQCCHNTCSLANLEGYCN	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation	Hydrolagus colliei [Animal]	YES
3291	MYP_122683	TCTSTNTNSDYREEETALPLC	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
3292	MYP_122778	NDDPPISIDLTFHLLRNMIEMARIESQKEQAELNRKYLDEV	STANDARD	Hormone	Oncorhynchus mykiss,Salmo gairdneri [Animal]	NO
3293	MYP_122860	APR	STANDARD	Antidiabetic	not reported [other]	NO
3294	MYP_122872	SDSKIGDGCFGLPLDHIGSVSGLGCNRPVQNRPKQ	STANDARD	Hormone Endocrine Vasoactive Vasodilator Cardiovascular Metabolic regulation Physiological regulation Receptor modulation	Oxyuranus microlepidotus [Animal]	YES
3295	MYP_122880	YSTSDFIM	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
3296	MYP_122884	HALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Receptor modulation	Mus musculus [Animal]	YES
3297	MYP_122893	EPYLRF	STANDARD	Neuropeptide	not reported [other]	YES
3298	MYP_123004	CSCSSLLDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3299	MYP_123014	FCNDLHQQLNDLKACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWE	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
3300	MYP_123056	GAMPGVLRF	STANDARD	Neuropeptide	Caenorhabditis elegans [Animal]	NO