FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 163 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3241	MYP_061240	FAKKLKKLAKKL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
3242	MYP_061251	GETCAGGRCNTPGCSCSWPVCTRNGLPVC	STANDARD	Antimicrobial Anticancer	Viola abyssinica [Plant]	NO
3243	MYP_061319	DANSFLQSV	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
3244	MYP_061335	SKGLRHR	STANDARD	Anticancer	not reported [other]	NO
3245	MYP_061356	VKKFAWWWAFLKK	STANDARD	Antimicrobial Anticancer	porcine cathelicidin peptide [Animal]	YES
3246	MYP_061375	RDVCRNFMRRYQSRVIQGLV	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
3247	MYP_061386	CLSDGKPVS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3248	MYP_061396	GARELRRLERELRRLEKGGGGGGKLAALTFEHYWAQLTSC	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
3249	MYP_061401	SVTNEFCLK	STANDARD	Anticancer	Homo sapiens [Animal]	NO
3250	MYP_061408	VDKPFYLPRPRPPRRIYNR	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative	synthetic construct [Synthetic]	YES
3251	MYP_061429	CSTNTFSLSDYWGNNGAWCTLTHECMAWCK	STANDARD	Antimicrobial Spermicidal	Lactococcus lactis [Bacterium]	YES
3252	MYP_061454	AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE	STANDARD	Anticancer Cytotoxic Hormone Endocrine Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory	Mus musculus [Animal]	NO
3253	MYP_061498	XPASXEX	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	NO
3254	MYP_061509	FLGALFHALSKLL	STANDARD	Anticancer Cytotoxic	synthetic construct [Synthetic]	YES
3255	MYP_061516	RGDXK	NOT STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
3256	MYP_061525	KCFQWQRNMRKVR	STANDARD	Antimicrobial Antibacterial Antifungal	synthetic construct [Synthetic]	YES
3257	MYP_061533	LNQESARKSE	STANDARD	Antimicrobial Anticancer	not reported [other]	NO
3258	MYP_061565	FRAPYIASLLR	STANDARD	Cytotoxic Anti-proliferative	not reported [other]	NO
3259	MYP_061600	AKWVGDLTLCRWR	STANDARD	Anticancer	not reported [other]	NO
3260	MYP_061607	PEKFRPM	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO