FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 158 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
3141	MYP_116584	DVDPLTGFLFPKSSQENEVAEYPFKDQMDMIVKRGIVEQCCHKPCNIFDLQNYCN	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3142	MYP_116590	LPQYL	STANDARD	Metabolic regulation Antidiabetic Glucose metabolism Type 2 diabetes-related Signaling peptide Regulatory peptide	not reported [other]	NO
3143	MYP_116591	HSDGTFTSELSRLQDSARLQRLLQGLV	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory Feeding regulator	Rattus norvegicus [Animal]	YES
3144	MYP_116599	GKRSVGELEATIRMMGTGGVVSLPDEANAQTQERLRPYNIINDDSSHFDRKKRFPNN	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3145	MYP_116602	DLDGRSDTMVDSFPHVDSPCSVLSCVEEFPKIYRMKGFLDGVTDRENGRRTFKK	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3146	MYP_116607	NKRYCGAELVKVLSFLCDEFPDLHTTS	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3147	MYP_116634	SWFSPLLIAVVTLGLPQEAAATFPAMPLSNLFANAVLRAQHLHLLAAETYKEF	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3148	MYP_116752	KANKITITNDKGRLSKEEIE	STANDARD	Antidiabetic	not reported [other]	NO
3149	MYP_116779	YGGFLRRQFKVVT	STANDARD	Analgesic Pronociceptive Neuropeptide Neuromodulator Receptor modulation	Sus scrofa [Animal]	NO
3150	MYP_116790	QLYTTLSNKCCHIGCTKKSLAKFC	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3151	MYP_116795	NRGGIVEECCLRPCGMNQLLQYCKKVSAY	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3152	MYP_116819	LEGEDDPDRSMKLSFRA	STANDARD	Neuropeptide	Rattus norvegicus [Animal]	NO
3153	MYP_116841	GSSFLSPEHQKLQQRKESKKPPAKLQPR	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Growth regulation Development regulation Receptor modulation Sleep regulation Wake regulation	Canis lupus familiaris [Animal]	NO
3154	MYP_116851	LKEVQVRLEEHLECACATSNLNPDHREEETDVR	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
3155	MYP_116852	DMGRCQHHPRNCPGFN	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3156	MYP_116875	CYIQNCP	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
3157	MYP_116887	SPMQRSSMVRFG	STANDARD	Neuropeptide Neuromodulator Receptor modulation	Caenorhabditis elegans [Animal]	YES
3158	MYP_116953	RMMEYGTTMVSYQPL	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
3159	MYP_117010	QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNRNGHDYYGDYYQRHYDEDAAIGPH	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Growth regulation Development regulation	Mus musculus [Animal]	YES
3160	MYP_117103	VERNVPESEEKTEQFLRDLFEISRLQRRPAGFTPFRGKFHSQSLRGLSETKRIYNAIWPCKHCNKCKPGLLCKK	STANDARD	Hormone Endocrine Vasoactive Vasodilator Myotropic Receptor modulation	Bombina variegata [Animal]	YES