FUNCTION: DELIVERY / TARGETING

Found 2,578 peptides

Current Node: Delivery / Targeting | Page 15 of 129

Level 2 Subcategories

Drug delivery vehicle (2152) Barrier transport (0) Cell penetration (0) Targeting ligand (0) Tumor targeting (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
281	MYP_017459	HQSVNKE	STANDARD	Anticancer	not reported [other]	NO
282	MYP_017525	NFPI	STANDARD	Antimicrobial Antiviral Drug delivery Targeting	synthetic construct [Synthetic]	YES
283	MYP_017560	CGRKKRAARQRRRPPQ	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
284	MYP_017683	NYRWRCK	STANDARD	Cell binding Cell-penetrating peptide Cargo delivery	Homo sapiens [Animal]	YES
285	MYP_017718	RVCFLWQDGRCVF	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
286	MYP_017793	CGRKKRRQRRWWRPPQ	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
287	MYP_017892	HSDAVFTDNYTRLRKQMAVKKYLNSILN	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Homo sapiens [Animal]	YES
288	MYP_017978	VVLGKLYGRKKRRQRRR	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	NO
289	MYP_017996	CRLGIAC	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
290	MYP_018052	YIHYIF	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
291	MYP_018108	DVQPPGLKVWSDPF	STANDARD	Drug delivery BBB shuttle	not reported [other]	NO
292	MYP_018402	RRFWRRFRR	STANDARD	Cell-penetrating Drug delivery	not reported [other]	NO
293	MYP_018511	KALKKLLAKWLAAAKALL	STANDARD	Cell-penetrating peptide	synthetic construct [Synthetic]	NO
294	MYP_018555	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY	STANDARD	Analgesic Pronociceptive Hormone Endocrine Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation Calcium-regulatory peptide calcitonin family Cell-Cell Communication Drug Delivery Vehicle Blood-Brain Barrier	Mus musculus [Animal]; Rattus norvegicus [Animal]	NO
295	MYP_018663	LLRARWRRRRSRRFR	STANDARD	Antimicrobial Anticancer Hemolytic	Protein derived [Animal]	NO
296	MYP_018747	KXRKXRILFQYKXRKXR	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
297	MYP_018794	IYLATALAKWALKQGGRRRRRRR	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
298	MYP_018843	YXGFLRNHCHSSCHNHRGGRLSYSRRRFSTSTGR	NOT STANDARD	Drug Delivery Vehicle Blood-Brain Barrier	not reported [other]	NO
299	MYP_018877	TVDNPASTTNKDKLFAVRK	STANDARD	Cell-penetrating peptide Cargo delivery	not reported [other]	YES
300	MYP_018881	VGFGKAL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO