FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 144 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2861	MYP_106308	RHTRSYNHLEGDVRLRRLYSANKFFLCIDKTGKVDGTRRKNYPDSE	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
2862	MYP_106360	ISSQHLCGSHLVEALNLVCGDRGFFYNPR	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation	Katsuwonus pelamis [Animal]	NO
2863	MYP_106377	DLELLRISLLLIQSWLGPLQFLSRVFTNTLVFGTSHRVYEKLKDLEEGILALMR	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
2864	MYP_106441	CSNLSTCVLGKLSQELHKLQTYPRTNTGNGTP	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
2865	MYP_106456	CQGENGTKP	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2866	MYP_106475	QPYVALFEKCCLIGCTKRSLANYC	STANDARD	Hormone Endocrine Reproductive regulator	Pan troglodytes [Animal]	YES
2867	MYP_106486	ALILTLVS	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
2868	MYP_106757	GPGVVDECCFRPCKLEVLKSFFFFFCD	STANDARD	Hormone Endocrine Growth regulation Development regulation	Bombyx mori [Animal]	YES
2869	MYP_106786	VICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCL	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
2870	MYP_106823	SALLVREEGLMQNCNQMHAS	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2871	MYP_106873	YKPITN	STANDARD	Cell-Cell Communication Quorum Sensing	not reported [other]	YES
2872	MYP_106951	KSVRGKGKGQKRKRKKSRFKSWSV	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
2873	MYP_106986	KCNPKGFTNEGCRGIDKKHWNSQCRTSQSYVRALTMDSRKKIG	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
2874	MYP_107130	WPPRPQIPP	STANDARD	Antihypertensive	not reported [other]	YES
2875	MYP_107133	TGSSLPDCSYACGACSPCKRVMISFECSVAESCSVIYRCTCRGRYYHVPSRA	STANDARD	Growth regulation Development regulation Receptor modulation	Arabidopsis thaliana [Plant]	YES
2876	MYP_107164	QIPGLGPLR	STANDARD	Hormone Endocrine Vasoactive Vasodilator Receptor modulation	Bombina maxima [Animal]	YES
2877	MYP_107238	AAASNPARYCCLSGCSQQDLLTLCP	STANDARD	Hormone Endocrine Receptor modulation	Callithrix jacchus [Animal]	YES
2878	MYP_107292	YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY	STANDARD	Neuropeptide Hormone Vasoregulatory peptide	Mus musculus [Animal]	NO
2879	MYP_107337	LTTMQLYRFIKIPTHAEP	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2880	MYP_107377	GRKLPSMTTTEEFQRLSFDGKRILSEVTADKKYDRIYGASARLVPKGPNPLHNK	STANDARD	Growth regulation Development regulation Receptor modulation ACE inhibitory	Arabidopsis thaliana [Plant]	NO