FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 144 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2861	MYP_054235	DDESEQFSYHLSSFNSV	STANDARD	Anticancer Antimicrobial Antibacterial	synthetic construct [Synthetic]	NO
2862	MYP_054263	DFVLPPP	STANDARD	Anticancer Antibacterial Antimicrobial	not reported [other]	NO
2863	MYP_054273	ELVRRILSR	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
2864	MYP_054275	GLPVCGETCFGGTCNTPGCSCETWPVCSRN	STANDARD	Anticancer Cytotoxic Enzymatic-degradation Antimicrobial	Viola arvensis [Plant]; Viola tricolor [Plant]	YES
2865	MYP_054280	MRKEFHNVLSSGQLLADKRPARDYNRK	STANDARD	Antibacterial Anticancer Antimicrobial Cytotoxic Anti-Gram-positive Anti-Gram-negative	not reported [other]	NO
2866	MYP_054294	VLQELNVTV	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
2867	MYP_054314	DDDDKRAGSPSGGPFCALARQPLTGSPPNERAFFCSSRDV	STANDARD	Anti-angiogenic	synthetic construct [Synthetic]	NO
2868	MYP_054414	FHIVELLALDQSLSLSVDGGNPKIIT	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
2869	MYP_054416	VKLRSLLCS	STANDARD	Antimicrobial Anticancer Cytotoxic	garlic [other]	NO
2870	MYP_054426	VPVFPPLXPI	NOT STANDARD	Antimicrobial Anticancer	Callyspongia aerizusa [Animal]	YES
2871	MYP_054430	LGTYTQDFNKFHTFPQTAIGVGAP	STANDARD	Cell-penetrating peptide Cargo delivery	Homo sapiens [Animal]	NO
2872	MYP_054451	NKWKKILGKIIKVVK	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
2873	MYP_054478	RLGPTLMCL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
2874	MYP_054507	MCQWGRLWQL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
2875	MYP_054535	GSGSGSGSGAGYLLGKINLKALAALAKKILGC	STANDARD	Antimicrobial Anticancer Cytotoxic	Protein derived [Animal]	NO
2876	MYP_054540	GLLKRIXTLL	NOT STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
2877	MYP_054559	CG	STANDARD	Antioxidant Anticancer	not reported [other]	NO
2878	MYP_054562	VENLHLPLPLL	STANDARD	Antihypertensive	Bos taurus [Animal]	YES
2879	MYP_054574	LRRLDRWLRLFNRLRRWFLRLLRGL	STANDARD	Antimicrobial Anticancer	membrane disrupting antimicrobial peptide KL15 [Animal]	YES
2880	MYP_054612	RQIKIWFQNARMKWKK	STANDARD	Cell-penetrating peptide	Drosophila melanogaster [Animal]	YES