FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 142 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2821	MYP_104815	VFDSLGGYEVHGF	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Feeding regulator	Aplysia californica [Animal]	YES
2822	MYP_104820	SIRAPQLRLRF	STANDARD	NPY-family Neuropeptide Neuromodulator	Aedes aegypti [Animal]	NO
2823	MYP_104846	SHLVEALY	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2824	MYP_104854	QEVHFKIGPAKIIAKPNNARVMPTWGEEKKWHKHPSGPNPTGNRHPPVKH	STANDARD	Growth regulation Development regulation ACE inhibitory	Arabidopsis thaliana [Plant]	NO
2825	MYP_104970	RLVLEVXASVEADV	NOT STANDARD	Vasoactive Vasodilator Cardiovascular Myotropic Receptor modulation	Lycosa erythrognatha [Animal]	YES
2826	MYP_105001	QEVARTYCGRHLANILAYVCFGVE	STANDARD	Hormone Endocrine Growth regulation Development regulation	Bombyx mori [Animal]	YES
2827	MYP_105018	QSRIGLW	STANDARD	Neuropeptide	not reported [other]	YES
2828	MYP_105031	RIRKPIFAFPRF	STANDARD	Receptor modulation ACE inhibitory	Conus cancellatus [Animal]	YES
2829	MYP_105063	GRSSMVGGRGCFGMKIDRIGSISGLGC	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation	Takifugu rubripes [Animal]	YES
2830	MYP_105068	AARAGPNLMRF	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
2831	MYP_105093	HEKPSALLKGRTACCHSET	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
2832	MYP_105110	LRTNKGTHYQRMTRMSK	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
2833	MYP_105144	QDVDHVFLRF	STANDARD	Neuropeptide Neuromodulator Myotropic	Namaquaphasma ookiepense [Animal]	YES
2834	MYP_105217	KPPSLWS	STANDARD	Neuropeptide	not reported [other]	YES
2835	MYP_105404	AYRKPPFNGSIF	STANDARD	RFamide Neuropeptide Neuromodulator	Lucilia cuprina [Animal]	YES
2836	MYP_105423	ERDMHGFSFGLG	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
2837	MYP_105500	GYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRR	STANDARD	Antimicrobial Anti-Gram-negative Antibacterial Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Myotropic Receptor modulation Immunomodulatory	Homo sapiens [Animal]	YES
2838	MYP_105534	LPLLALLAL	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2839	MYP_105550	EVASAETLCGGELVDALQFVCEDRGFYFSRPTSRSNSRRSQNRGIVEECCFRSCDLNLLEQYCAKPAKSE	STANDARD	Hormone Endocrine Growth regulation Development regulation	Oncorhynchus mykiss [Animal]	YES
2840	MYP_105634	LKLLEEVLYLAQSKNF	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO