FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 128 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2541	MYP_048125	LLXXLAAAALXXLL	NOT STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
2542	MYP_048140	XGV	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
2543	MYP_048151	DYPSMAMYSPSVK	STANDARD	Anticancer Drug delivery Targeting	synthetic construct [Synthetic]	YES
2544	MYP_048157	KILRGVSKKIMRRILTGKK	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
2545	MYP_048164	LPLV	STANDARD	Anticancer Antitumor	synthetic construct [Synthetic]	YES
2546	MYP_048168	FLSLALAALPKFLCLVFKKC	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Rana amurensis [Animal]	YES
2547	MYP_048196	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN	STANDARD	Antiviral Anti-SARS-CoV-2 Immunomodulatory Cytokine Growth factor alpha beta interferon family Antibacterial Host defense Antimicrobial Anticancer Enzyme replacement Immunosuppressive	Homo sapiens [Animal]; Cricetulus griseus [Animal]	NO
2548	MYP_048248	GFXGXXXGXFXGXGXXXXXX	NOT STANDARD	Antimicrobial Antimycobacterial Antibacterial	synthetic construct [Synthetic]	YES
2549	MYP_048254	RPILIIITL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
2550	MYP_048264	HHHRRRRRRRR	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
2551	MYP_048275	GSVSHRR	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
2552	MYP_048311	MRPEIWFAQELDRAGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	YES
2553	MYP_048312	XVI	NOT STANDARD	Anticancer	synthetic construct [Synthetic]	YES
2554	MYP_048327	HLIAEIHTA	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
2555	MYP_048354	VNSHQALWSPAQ	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
2556	MYP_048357	FLGALFKALSKLL	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
2557	MYP_048380	FLPVLAGLTPSIVPKLVCLLTKKC	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative Hemolytic Cytolytic Anticancer	not reported [other]	NO
2558	MYP_048442	LRLLTPKHFNRIGLTIAKKNVKRAHERNRIKRLARELDFVVLTEVL	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
2559	MYP_048443	YSXG	NOT STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
2560	MYP_048468	FLPFLKSILGKIL	STANDARD	Antimicrobial Antibacterial Anticancer Antitumor Anti-Gram-positive Anti-Gram-negative	Rana okaloosae [Animal]	YES