FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 126 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2501	MYP_047281	FVSACSVAG	STANDARD	Anticancer	not reported [other]	NO
2502	MYP_047285	APPGARPPPGPPPPGPPPPGP	STANDARD	Antifungal	Sus scrofa [Animal]	YES
2503	MYP_047295	MNKLFIVALVLALAVATMAHEVHDDIEEPSVPRVRRGFGCPFNQYECHAHCSGVPGYKGGYCKGLFKQTCNCY	STANDARD	Anticancer Antiparasitic Antifungal Antibacterial Antimicrobial	not reported [other]	NO
2504	MYP_047298	KGCGTRQCW	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
2505	MYP_047351	FKRIVQLLKKLLR	STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
2506	MYP_047354	WELVVLGYGRKKRRQRRR	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
2507	MYP_047355	ALWKTIIKGAGKMIGSLAKNLLGSQAQPES	STANDARD	Antimicrobial Anti-Gram-negative	Phyllomedusa bicolor [Animal]	YES
2508	MYP_047364	LKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR	STANDARD	Antimicrobial Antibacterial Antibiofilm Anti-Gram-positive	Dengue virus [Virus]	YES
2509	MYP_047391	FALGNVISA	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
2510	MYP_047393	MQMKYLIPIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKRDITSQIEQYRNLQKREAELEDILANLPVY	STANDARD	Antimicrobial Antifungal Anti-MRSA Antibiofilm Anti-Candida Anti-Gram-positive Anticancer Hemolytic	Tityus costatus [Animal]	NO
2511	MYP_047399	FVQWFSKFLG	STANDARD	Antimicrobial Antibacterial	not reported [other]	NO
2512	MYP_047403	RRNDLRSXFLTLRDXVP	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
2513	MYP_047463	GKPICGETCFKGKCYTPGCTCSYPICKKD	STANDARD	Antimicrobial Anticancer	Melicytus latifolius [Animal]	YES
2514	MYP_047517	WYANFAKLLA	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
2515	MYP_047567	VTCGDGVITR	STANDARD	Anticancer Anti-angiogenic	not reported [other]	NO
2516	MYP_047610	KFLGPAEHLTF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
2517	MYP_047613	CDPSRGKNC	STANDARD	Anticancer	not reported [other]	NO
2518	MYP_047619	SVLTPSLSSLGESLESGIS	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Myotropic	Aplysia californica [Animal]	NO
2519	MYP_047627	LLKWLKKWL	STANDARD	Antibacterial Anti-Gram-positive Anticancer Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
2520	MYP_047632	VDKPPYLPRPRPXRXIYNX	NOT STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES