FUNCTION: REGULATORY PEPTIDE

Found 4,652 peptides

Current Node: Regulatory peptide | Page 118 of 233

Level 2 Subcategories

Biological regulation (2953) Biological modulation (1391) Cell-cell communication (1015) Stimulation activity (92) Activation activity (48) Cell signaling / Growth factor signaling (18) Chemical communication (0) Receptor signaling modulation (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2341	MYP_086392	AVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISD	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Myotropic Receptor modulation	Bos taurus [Animal]	NO
2342	MYP_086443	GWRPNSREDSVEAGLPLQVRGYPEE	STANDARD	Antimicrobial Anti-Gram-negative Hormone Endocrine Cardiovascular Metabolic regulation Physiological regulation Receptor modulation Immunomodulatory	Bos taurus [Animal]	NO
2343	MYP_086519	NTGDKFYGLM	STANDARD	Neuropeptide Neuromodulator Vasoactive Vasodilator Metabolic regulation Physiological regulation Immunomodulatory Feeding regulator	Aedes aegypti [Animal]	YES
2344	MYP_086559	VNFFRMVISNPAAT	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2345	MYP_086622	AVALPRI	STANDARD	Neuropeptide	not reported [other]	NO
2346	MYP_086679	YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Vasoactive Vasoconstrictor Receptor modulation	Canis lupus familiaris [Animal]	YES
2347	MYP_086689	ASWGEFQ	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Growth regulation Development regulation	Rattus norvegicus [Animal]	YES
2348	MYP_086712	DINGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPRHVSPYFSYP	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
2349	MYP_086792	NGPGPWQGGRRKFRRQRPRLSHKGPMPF	STANDARD	Cell-Cell Communication	not reported [other]	NO
2350	MYP_086805	VRQWNLTEFVLDTHP	STANDARD	Stimulatory	not reported [other]	NO
2351	MYP_086816	VFWLIQISV	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2352	MYP_086909	PSLWEIEFAKQLAS	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2353	MYP_086942	LLVLLEVVASLKNGKEICLDPEAPLIKKAIQKILESGNKEN	STANDARD	Signaling peptide Cell-cell communication Cytokine activity	not reported [other]	NO
2354	MYP_086957	FYLKNVQTQETRT	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2355	MYP_087015	SEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG	STANDARD	Secretory granule peptide Neuropeptide precursor	Homo sapiens [Animal]	NO
2356	MYP_087024	TRSAWPGTTGSGLLEDPQPHTSPTSTSLEPSSR	STANDARD	Neuropeptide	not reported [other]	NO
2357	MYP_087208	LPSQHLCGSHLVEALYFVCGPKGFYYLPKXXV	NOT STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation	Squalus acanthias [Animal]	NO
2358	MYP_087306	GGSSRSGCFGHKMDRIGTISGMGC	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation	Takifugu rubripes [Animal]	NO
2359	MYP_087329	QPPSTNKKMKSQRRRKGGPKK	STANDARD	Metabolic	not reported [other]	NO
2360	MYP_087402	HADGIFTSVYSHLLAKLAVKRYLHSLI	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Vasoactive Vasodilator Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation	Gallus gallus [Animal]	NO