FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 114 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2261	MYP_042786	RGDPAYNGRFL	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
2262	MYP_042815	RLDDLKMTV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
2263	MYP_042879	NLRDLLSEV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
2264	MYP_042885	KRWHWWRRHWVVW	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
2265	MYP_042891	GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME	STANDARD	Antimicrobial Antibacterial	not reported [other]	YES
2266	MYP_042954	KLVKKLLKKYITF	STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	YES
2267	MYP_042955	KKKLLLLLKKK	STANDARD	Anticancer	not reported [other]	NO
2268	MYP_042980	FLSGIVGMLYKLF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
2269	MYP_042985	EHNAYHSIEWAI	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	YES
2270	MYP_043000	GFGSKPIDSF	STANDARD	Anticancer	not reported [other]	NO
2271	MYP_043008	RSTEDIIKSISGGGFLNAMNA	STANDARD	Antimicrobial Antibacterial Antifungal Anti-Gram-positive Anti-Gram-negative	Pseudopleuronectes americanus [Animal]	YES
2272	MYP_043062	HGGGWGQPHGGGWG	STANDARD	Antimicrobial Anticancer Antiviral	Homo sapiens [Animal]	NO
2273	MYP_043067	YLVPQQGFFC	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
2274	MYP_043095	XXLPXTXPXQX	NOT STANDARD	Anticancer Immunomodulating	not reported [other]	NO
2275	MYP_043104	GLFDIVKKLKSLF	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
2276	MYP_043110	VVRWWWRVV	STANDARD	Antibacterial Anti-Gram-positive Anticancer Antimicrobial Cytotoxic Toxin-related activity Anti-Gram-negative	not reported [other]	NO
2277	MYP_043136	WXLXNX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
2278	MYP_043157	MRPEIWAAQEARRIGDENNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
2279	MYP_043160	VKRFKKFFRKLKKDV	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
2280	MYP_043173	IHWRPWAR	STANDARD	Antimicrobial Anticancer	not reported [other]	NO