FUNCTION: ENZYME MODULATION

Found 7,157 peptides

Current Node: Enzyme modulation | Page 112 of 358

Level 2 Subcategories

Enzyme inhibition (3665) Receptor tyrosine kinase inhibition (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2221	MYP_055373	GLLYFAIFFVAAWHIRGR	STANDARD	Antimicrobial Antiviral Hemolytic	synthetic construct [Synthetic]	NO
2222	MYP_055375	VXG	NOT STANDARD	Enzyme inhibitory ACE inhibitory	Bos taurus [Animal]	YES
2223	MYP_055396	VGPAGRPG	STANDARD	Enzyme inhibitory ACE inhibitory	Volutharpa ampullacea perryi [Animal]	YES
2224	MYP_055397	WVP	STANDARD	Enzyme inhibitory ACE inhibitory	Bos taurus [Animal]	YES
2225	MYP_055418	EGAGSKVP	STANDARD	Enzyme inhibitory	Stichopus horrens [Animal]	NO
2226	MYP_055428	GRWPVKT	STANDARD	Antiviral Integrase inhibition	synthetic construct [Synthetic]	YES
2227	MYP_055445	RA	STANDARD	Antihypertensive	Bos taurus [Animal]; Actinopterygii [Animal]; Poaceae [Plant]; Sus scrofa [Animal]; Gallus gallus [Animal]	NO
2228	MYP_055462	QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory Feeding regulator	Homo sapiens [Animal]	NO
2229	MYP_055482	ACWWAGIRQEF	STANDARD	Antiviral Integrase inhibition	synthetic construct [Synthetic]	YES
2230	MYP_055517	DDQNPH	STANDARD	Antihypertensive Cholesterol-lowering Hypocholesterolemic	Bos taurus [Animal]	YES
2231	MYP_055559	KLLSHSL	STANDARD	Antimicrobial Antibacterial Enzyme inhibitory Anti-Gram-positive Anti-Gram-negative	Bos taurus [Animal]	YES
2232	MYP_055592	TLQPPSALRRRHYHHALPPSR	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Reproductive regulator Growth regulation Development regulation Immunomodulatory ACE inhibitory	Homo sapiens [Animal]	YES
2233	MYP_055628	AKLEK	STANDARD	Antihypertensive ACE inhibitory	not reported [other]	NO
2234	MYP_055681	FVEPIP	STANDARD	Enzyme inhibitory ACE inhibitory	Homo sapiens [Animal]	NO
2235	MYP_055685	YYPL	STANDARD	Antidiabetic Alpha-glucosidase inhibitory	not reported [other]	YES
2236	MYP_055699	FLREDLAF	STANDARD	Antiviral Antimicrobial	not reported [other]	NO
2237	MYP_055727	DVSASTTVLPDDFTAYPVGKFFQSDTWKQSTQRL	STANDARD	Hormone Endocrine Metabolic regulation Physiological regulation Growth regulation Development regulation ACE inhibitory	Ovis aries [Animal]	NO
2238	MYP_055741	EPVESRNYIEYGAINKCAGPNPPPGCNPPGAEQKNPNPVNEYSRGCSKIHRCRRD	STANDARD	Hormone Endocrine Growth regulation Development regulation Receptor modulation ACE inhibitory	Arabidopsis thaliana [Plant]	YES
2239	MYP_055809	HSGFLLAWSGPRNRFVRF	STANDARD	Toxin	Conus victoriae [Animal]	NO
2240	MYP_055811	PKPP	STANDARD	Antihypertensive ACE inhibitory	not reported [other]	NO