FUNCTION: REGULATORY PEPTIDE > BIOLOGICAL REGULATION

Found 2,953 peptides

Current Node: Biological regulation | Page 111 of 148

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2201	MYP_129285	SFRNGVGSGAKKTSFRRAKQ	STANDARD	Neuropeptide Neuromodulator Receptor modulation Immunomodulatory ACE inhibitory Sleep regulation Wake regulation	Mus musculus [Animal]	NO
2202	MYP_129386	PDVGGFMVEDQRTHKSHNYMM	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Growth regulation Development regulation	Bombyx mori [Animal]	NO
2203	MYP_129430	HPITESAEMPYPGPASLEERGVGSLDDLSLSEQNYPPQRGAGLRYATL	STANDARD	Hormone Endocrine Cardiovascular Metabolic regulation Physiological regulation	Platichthys flesus [Animal]	YES
2204	MYP_129484	NDVNTMADAYKFLQDLDTYYGDRARVRF	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation Feeding regulator	Drosophila pseudoobscura pseudoobscura [Animal]	NO
2205	MYP_129492	AKGTTGFEAHVDKCL	STANDARD	Metabolic	not reported [other]	NO
2206	MYP_129503	AADGAPLIRF	STANDARD	Neuropeptide Neuromodulator Receptor modulation Sleep regulation Wake regulation	Caenorhabditis briggsae [Animal]	YES
2207	MYP_129546	VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL	STANDARD	Hormone Endocrine Cardiovascular Metabolic regulation Physiological regulation Growth regulation Development regulation Receptor modulation ACE inhibitory Feeding regulator	Mus musculus [Animal]	YES
2208	MYP_129549	GIVEQCCHNPCSLYQL	STANDARD	Metabolic	not reported [other]	NO
2209	MYP_129636	HADGVFTSDYSRLLGQLSAKKYLESLI	STANDARD	Hormone Endocrine Neuropeptide Neuromodulator Vasoactive Vasodilator Cardiovascular Growth regulation Development regulation Receptor modulation	Bos taurus [Animal]	YES
2210	MYP_129672	EAKQKGFVPFLVSATAGTTV	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2211	MYP_129695	WGPDPAAAFVNQHL	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2212	MYP_129955	PSLSYEPALLQPY	STANDARD	Antidiabetic Type 1 diabetes-related Metabolic regulation Glucose metabolism Signaling peptide Regulatory peptide	not reported [other]	NO
2213	MYP_130055	FPAMPLSSLFANAVLRAQHLHQLVADTYKEFERTYIPEAQ	STANDARD	Metabolic regulation Hormonal activity	not reported [other]	NO
2214	MYP_130100	RILRVNSKTKDGESNDLLKRLGYNVSELKRIGRELSVQNEVDRFSPGGPDPQHHSYPLSSKPRI	STANDARD	Growth regulation Development regulation ACE inhibitory	Arabidopsis thaliana [Plant]	NO
2215	MYP_130502	SSPETLISDLLMRESTENVPRTRLEDPSMW	STANDARD	NPY-family Neuropeptide Neuromodulator	Macaca mulatta [Animal]	NO
2216	MYP_130503	SDSKIGDGCFGLPLDHIGSVSGLGCNRPVQNRPKQIPGGS	STANDARD	Hormone Endocrine Vasoactive Vasodilator Cardiovascular Metabolic regulation Physiological regulation Receptor modulation	Oxyuranus microlepidotus [Animal]	YES
2217	MYP_130516	VQGSGCFGRKMDRISSSSGLGCKVLRRH	STANDARD	Cell-Cell Communication	not reported [other]	YES
2218	MYP_130586	APVSVGGGTVLAKMYPRGNHWAVGHLM	STANDARD	Hormone	Sus scrofa [Animal]; Cavia porcellus [Animal]	NO
2219	MYP_130615	FEFALTAVAEEVNAIL	STANDARD	Antidiabetic	not reported [other]	NO
2220	MYP_130648	NTVVLGKKQRFHSWG	STANDARD	Metabolic regulation Physiological regulation Myotropic	Musca domestica [Animal]	YES