FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 110 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
2181	MYP_041240	GEFLKCGESCVQGECYTPGCSCDWPICKKN	STANDARD	Anticancer	Clitoria ternatea [Plant]	NO
2182	MYP_041246	EYSRRHPQL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
2183	MYP_041265	MRPEIWIAQEADRIGDEVNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	synthetic construct [Synthetic]	NO
2184	MYP_041266	SPMYGQAGL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
2185	MYP_041269	GIKCRFCCGCCTPGICGVCCRF	STANDARD	Antimicrobial Antibacterial Antifungal Antiviral Anticancer	Oreochromis mossambicus [Animal]	NO
2186	MYP_041274	XIXIXRPVYXPRPRPPHPRL	NOT STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	YES
2187	MYP_041277	XXVXXV	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Bacteria [Bacterium]	NO
2188	MYP_041295	KNIRRIIRKIIHIIKKYG	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	YES
2189	MYP_041364	GIIKKIIKKIIKKI	STANDARD	Anticancer Toxic Antimicrobial Hemolytic Antitumor	not reported [other]	NO
2190	MYP_041375	YKRAARRAARR	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
2191	MYP_041384	HGRFILPWWYAFSPS	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	NO
2192	MYP_041399	NYQWRCKNQN	STANDARD	Antimicrobial Anticancer Cytotoxic	Protein derived [Animal]	NO
2193	MYP_041435	CGRKKRRQRRRPPQ	STANDARD	Drug Delivery Vehicle Cell-penetrating peptide	not reported [other]	NO
2194	MYP_041441	VAKLLAKLAKKLL	STANDARD	Anticancer	synthetic construct [Synthetic]	NO
2195	MYP_041449	KWCFRVCYRGFCYRRCRK	STANDARD	Antimicrobial Anticancer	host defense peptide from the horseshoe crab Tachypleus tridentatus [other]	YES
2196	MYP_041520	APCCSHLDASPFQRP	STANDARD	Anticancer	not reported [other]	NO
2197	MYP_041546	KCVRQNNKRVCK	STANDARD	Antimicrobial Anticancer Hemolytic	Synthetic construct [Synthetic]	YES
2198	MYP_041549	FLHHIVGLIHHGLSLFGDRAD	STANDARD	Antimicrobial Anticancer Cytotoxic	Gadus morhua [Animal]	YES
2199	MYP_041559	RXRRXRIKFQYRXRRXR	NOT STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	YES
2200	MYP_041560	VRRFLVTLRIRRA	STANDARD	Antimicrobial Anticancer	Protein derived [Animal]	YES