FUNCTION: ENZYME MODULATION > ENZYME INHIBITION
Level 3 Subcategories
Protease inhibition
(534)
Integrase inhibition
(283)
Invertebrate inhibitory neuropeptide
(254)
Inhibitor
(130)
Lipase inhibition
(75)
Infection inhibition
(70)
DPP-III Inhibitory
(66)
Reverse transcriptase inhibition
(62)
CaMKII Inhibitory
(50)
nNOS inhibitor
(50)
Vif multimerization inhibitor
(43)
HMG-CoA Reductase Inhibitory
(28)
Tripeptidyl Peptidase II Inhibitory
(28)
Inhibitory neuropeptide
(27)
Maturation inhibitor
(27)
Binding inhibition
(24)
BChE Inhibitory
(22)
Biosynthesis Inhibitor
(19)
Blood coagulation cascade inhibitor
(19)
Helicase inhibition
(16)
Myoinhibitory peptide
(12)
Syncytium formation inhibitor
(12)
Lipoxygenase Inhibitory
(11)
Trypsin inhibitor
(11)
Xanthine oxidase inhibition
(11)
Complement inhibitor
(10)
Protein Synthesis Inhibitor
(10)
Inhibition of IL-8 production
(9)
COX-1 Inhibitory
(8)
COX-2 Inhibitory
(8)
Cell Aggregation Inhibitor
(7)
Cyclooxygenase-inhibitor
(7)
Glutamate Carboxypeptidase Inhibitor
(7)
Inhibition of ileum cells contraction
(7)
Inhibition of vas deferens cells contraction
(7)
Inhibitor Of Complement Pathway
(7)
Inhibitor Of Cytosol Alanyl Aminopeptidase
(7)
XIAP inhibitory
(7)
Tubulin-Tyrosine Ligase Inhibitor
(6)
Alanine Carboxypeptidase Inhibitor
(5)
Calpain-1 inhibitory
(5)
Growth inhibitors
(5)
Ligand Binding Inhibitor
(5)
Metalloenzyme inhibitor
(5)
Proteasome inhibitor
(5)
CPE inhibition
(4)
Cyclooxygenase-2 inhibitory
(4)
Digestion Inhibitor
(4)
Lactocepin Inhibitor
(4)
Reverse transcriptase inhibitory
(4)
Cathepsin B inhibitory
(3)
Cholesterol esterase inhibitory
(3)
Defensive-proteinase-inhibitor
(3)
HMG-CoA-reductase-inhibitor
(3)
Leucyltransferase Inhibitor
(3)
Precipitation Inhibitor
(3)
Prolyl endopeptidase inhibitory
(3)
Protein Inhibitor
(3)
Receptor inhibitory
(3)
Calpain 2 Inhibitor
(2)
Cell Growth Inhibitor
(2)
Factor XIa inhibitory
(2)
Farnesyltransferase inhibitory
(2)
Furin inhibitory
(2)
Gene expression inhibitor
(2)
IL-1beta inhibitor
(2)
Inhibition of BK-induced muscle contraction
(2)
Inhibition of TNF-alpha production
(2)
Ion Transport Inhibitor
(2)
Neprilysin Inhibitor
(2)
Peptide Inhibitor
(2)
Pheromone Inhibitor
(2)
Protein Translation Inhibitor
(2)
Protein kinase inhibitor
(2)
Protein prenyltransferase inhibitor
(2)
Protein-Binding Inhibitor
(2)
Salt Precipitation Inhibitor
(2)
Sex Pheromone Inhibitor
(2)
Xaa-Pro Inhibitor
(2)
Acylaminoacyl Peptidase Inhibitor
(1)
Alkaline Phosphatase Inhibitor
(1)
Apoptosis Inhibitor
(1)
Bile-acid-binding-inhibitor
(1)
Calcineurin inhibitor
(1)
Calpain 1 Inhibitor
(1)
Cardiac fibrosis Inhibitor
(1)
Coagulation factor VIIa peptide exosite inhibitor
(1)
Complement inhibition
(1)
Cyclophilin inhibitor
(1)
D-Ala-D-Ala Dipeptidase Inhibitor
(1)
EGFR inhibitor
(1)
Glucagon secretion inhibition
(1)
Granulopoiesis inhibition
(1)
HDAC inhibitor
(1)
Hematopoietic stem cell proliferation inhibition
(1)
Inhibition of prolyl endopeptidase
(1)
Inhibitor Of Endothelin-1 Release
(1)
Inhibitor of trypsin and chymotrypsin biosynthesis
(1)
Insulin secretion inhibition
(1)
Integrin inhibitor
(1)
Mimic putative inhibitor epitopes (mimotopes)
(1)
Mirabilis serine proteinase inhibitor family
(1)
NS5A inhibitor
(1)
Neprilysin 2 Inhibitor
(1)
Neurolysin Inhibitor
(1)
Neurotensin-inhibitor
(1)
Neutrophil Inhibitor
(1)
Pam Inhibitor
(1)
Photosynthesis Inhibitor
(1)
Post-attachment inhibitor
(1)
Prolyl oligopeptidase inhibitory
(1)
Protein Kinase C Inhibitor
(1)
Protein Prenyltransferases Inhibitor
(1)
Protein Transport Inhibitor
(1)
Protein farnesyltransferase inhibitor
(1)
Pseudolysin Inhibitor
(1)
RANKL inhibitor
(1)
Reactivation inhibitor
(1)
Thymidylate Synthase Inhibitor
(1)
ACE inhibition
(0)
Amylase inhibition
(0)
DPP-IV inhibition
(0)
Glutamate carboxypeptidase II inhibition
(0)
Glycosidase inhibition
(0)
Matrix enzyme inhibition
(0)
Phosphodiesterase inhibition
(0)
Renin inhibition
(0)
Thrombin inhibition
(0)
Tyrosinase inhibition
(0)
Results
Showing up to 20 records.
| NO. | PEPTIDE ID | SEQUENCE | STATUS | BIOLOGICAL FUNCTIONS | SOURCE ORGANISM | VERIFIED |
|---|---|---|---|---|---|---|
| 2081 | MYP_051387 | VVXQGGF |
NOT STANDARD | synthetic construct [Synthetic] |
YES | |
| 2082 | MYP_051395 | RRRRRRRWWWRRRRRRRR |
STANDARD | synthetic construct [Synthetic] |
YES | |
| 2083 | MYP_051417 | RADHPFL |
STANDARD | not reported [other] |
NO | |
| 2084 | MYP_051433 | VNRPGK |
STANDARD | Pisum sativum [Plant] |
NO | |
| 2085 | MYP_051457 | PGI |
STANDARD | Bos taurus [Animal] |
YES | |
| 2086 | MYP_051460 | YNVEHAVDYVERA |
STANDARD | synthetic construct [Synthetic] |
NO | |
| 2087 | MYP_051500 | APKAMRLLRRLLRRLLR |
STANDARD | synthetic construct [Synthetic] |
YES | |
| 2088 | MYP_051532 | RYW |
STANDARD | Saccharomyces cerevisiae [Fungus] |
YES | |
| 2089 | MYP_051536 | DFHQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYSTIWDGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERYNLWFDPTEMGFITRFLVFMSLFTSLVSGFALQKLPLIQFDEGYTQLFGDQNLIVHRDGRLASEITESQRNKMEIFRQKHMTYSYCYDHMRYKVVLSECVVNPAEAKRLRVYDPVTFGGIPHGHRRGKHRSRSRLARTESISKWATDGGKYGVNYKYAPYVSQFTDLILHGCAVDPTEKFPSCKDEAVQNL |
STANDARD | Arabidopsis thaliana [Plant] |
NO | |
| 2090 | MYP_051573 | EFGYVAE |
STANDARD | not reported [other] |
YES | |
| 2091 | MYP_051577 | KKKKVVAPTYVLF |
STANDARD | synthetic construct [Synthetic] |
NO | |
| 2092 | MYP_051594 | QVPQPIP |
STANDARD | Homo sapiens [Animal] |
YES | |
| 2093 | MYP_051611 | LGGC |
STANDARD | not reported [other] |
NO | |
| 2094 | MYP_051632 | EDL |
STANDARD | Human immunodeficiency virus 1 [Virus] |
YES | |
| 2095 | MYP_051650 | PTHKAW |
STANDARD | not reported [other] |
NO | |
| 2096 | MYP_051660 | MRW |
STANDARD | not reported [other] |
NO | |
| 2097 | MYP_051678 | LYGNEGCGWAGWLLSPRG |
STANDARD | synthetic construct [Synthetic] |
YES | |
| 2098 | MYP_051753 | NY |
STANDARD | Allium sativum [Plant] |
NO | |
| 2099 | MYP_051791 | MRKDQ |
STANDARD | not reported [other] |
NO | |
| 2100 | MYP_051808 | VVW |
STANDARD | not reported [other] |
NO |