FUNCTION: ANTICANCER

Found 9,505 peptides

Current Node: Anticancer | Page 100 of 476

Level 2 Subcategories

Tumor Homing Peptide (660) Tumor T-cell antigen (508) Anti-proliferative (299) Antitumor (159) Apoptosis induction (96) tumor necrosis factor family (19) Cancer antigenic (15) Anti-breast cancer (9) Prostate cancer targeting (2) Anticancer adjunct (1) Tumor suppressor (1) Tumor-penetrating (1) Anti-angiogenic activity (0) Cytotoxic anticancer activity (0)

Results

Showing up to 20 records.

NO.	PEPTIDE ID	SEQUENCE	STATUS	BIOLOGICAL FUNCTIONS	SOURCE ORGANISM	VERIFIED
1981	MYP_036924	WGKIEDPLRA	STANDARD	Drug Delivery Vehicle Tumor Homing Peptide	not reported [other]	YES
1982	MYP_036949	FLKGIKGMLGKLL	STANDARD	Antimicrobial Anticancer	Pelophylax saharicus [Animal]	NO
1983	MYP_036975	GISCAETCVLLPCLSSVIGCTCQNKRCYKN	STANDARD	Antimicrobial Anticancer	Hedyotis biflora [Animal]	YES
1984	MYP_037012	GALFLGWLGAAGSTMGAPKKKRKV	STANDARD	Cell-penetrating peptide Cargo delivery	synthetic construct [Synthetic]	NO
1985	MYP_037013	GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN	STANDARD	Antimicrobial Antibacterial	Palicourea lasiantha [Plant]	YES
1986	MYP_037083	KPPQFTWAQWFETQHINMTSQQSTNAMQVINNYQRRSKNQNTFLL	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	NO
1987	MYP_037092	VYDQYFITL	STANDARD	Antimicrobial Anticancer	synthetic construct [Synthetic]	NO
1988	MYP_037111	GFMKTAKNVAKNVAATLLKLLK	STANDARD	Antimicrobial Anticancer	Synthetic construct [Synthetic]	YES
1989	MYP_037121	ATIVPELNEI	STANDARD	Anticancer	Homo sapiens [Animal]	NO
1990	MYP_037139	CLQKTPKQC	STANDARD	Antimicrobial Anticancer	not reported [other]	NO
1991	MYP_037142	WLLVAX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	synthetic construct [Synthetic]	NO
1992	MYP_037177	MRPEIWIAQEFDRIGDEFNAYYARRVX	NOT STANDARD	Antimicrobial Anticancer Cytotoxic	Synthetic construct [Synthetic]	NO
1993	MYP_037207	FFPLALLCKVFKKC	STANDARD	Antimicrobial Antibacterial Anti-Gram-positive Anti-Gram-negative Hemolytic	Rana dybowskii [Animal]	YES
1994	MYP_037225	KTKLFKKFAK	STANDARD	Anticancer	not reported [other]	NO
1995	MYP_037255	KLGVPLKAK	STANDARD	Antimicrobial Antifungal	synthetic construct [Synthetic]	YES
1996	MYP_037301	EYSKECLKEF	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO
1997	MYP_037320	XPX	NOT STANDARD	Antimicrobial Anticancer Hemolytic	Fungi [Fungus]	NO
1998	MYP_037375	YPVIFKSIM	STANDARD	Anticancer Immunogenic	Homo sapiens [Animal]	NO
1999	MYP_037460	GLFGVLAKVAAHVVPAIAEHF	STANDARD	Antimicrobial Antibacterial	synthetic construct [Synthetic]	NO
2000	MYP_037462	PLPPARNGGL	STANDARD	Immunomodulatory Tumor T-cell antigen T-cell epitope	not reported [other]	NO